(data stored in SCRATCH zone)

EMBL: CP002105.PE156

CP002105.PE156       Location/Qualifiers
FT   CDS_pept        175640..176008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0157"
FT                   /product="SSU ribosomal protein S12P"
FT                   /note="COGs: COG0048 Ribosomal protein S12; InterPro
FT                   IPR006032:IPR012340:IPR016027:IPR005679; KEGG:
FT                   hor:Hore_01120 ribosomal protein S12; PFAM: ribosomal
FT                   protein S12/S23; SPTR: B8D0B9 30S ribosomal protein S12;
FT                   TIGRFAM: ribosomal protein S12; PFAM: Ribosomal protein
FT                   S12; TIGRFAM: ribosomal protein S12, bacterial/organelle"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11708"
FT                   /db_xref="GOA:D9QTE4"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D9QTE4"
FT                   /protein_id="ADL11708.1"
FT                   /translation="MPTINQLIRKGRNKVKKKQTAPALEGAPQKRGVCTRVYTATPKKP
FT                   NSALRKVARVRLTNGKEVTAYIPGEGHNLQEHSVVLVRGGRVKDLPGVRYTIVRGALDT
FT                   AGVEDRKQARSKYGVKKP"
     atgcctacta tcaatcaatt gattcgtaaa ggaagaaata aggtaaagaa gaaacagact        60
     gctccggctt tggaaggggc gccacagaag cgaggtgtct gtacccgtgt ctatactgca       120
     acgcctaaaa agcctaattc tgctttaaga aaggtagccc gtgttcgatt aactaatgga       180
     aaagaagtta ctgcctatat tcccggcgaa ggacataatt tgcaggaaca ctctgtagtt       240
     ttggttagag gtggaagagt taaggactta ccaggggtta ggtatactat tgtccgtggt       300
     gctttagata ctgctggtgt tgaagacaga aagcaggctc gttctaaata cggagttaag       360
     aagccctaa                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page