(data stored in SCRATCH zone)

EMBL: CP002105.PE164

CP002105.PE164       Location/Qualifiers
FT   CDS_pept        181909..182745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0165"
FT                   /product="LSU ribosomal protein L2P"
FT                   /note="COGs: COG0090 Ribosomal protein L2;
FT                   InterProIPR002171:IPR012340:IPR014722:IPR008991:IPR
FT                   016027:IPR005880; KEGG: hor:Hore_01200 ribosomal protein
FT                   L2; PFAM: ribosomal protein L2; SPTR: B8D0C7 50S ribosomal
FT                   protein L2; TIGRFAM: ribosomal protein L2; PFAM: Ribosomal
FT                   Proteins L2, RNA binding domain; Ribosomal Proteins L2,
FT                   C-terminal domain; TIGRFAM: ribosomal protein L2,
FT                   bacterial/organellar"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11716"
FT                   /db_xref="GOA:D9QTF2"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/TrEMBL:D9QTF2"
FT                   /protein_id="ADL11716.1"
FT                   /translation="MAIKTFKPTSPSRRYMTVDTFEEVTTDESEKSLLAPLKKSGGRNV
FT                   NGRITSRRRGGGHKRKYRIIDFKRDKDGVPAKVATIEYDPNRSAYIALLNYADGEKRYI
FT                   LAPRGIEVGEKIMSGPEAEIKPGNALQMKDMPVGTIIHNLELQPGKGGQLVRSAGAQAR
FT                   LMAKEEQYVHVNLPSGEVRLIPAECKATVGQVGNIEHENITLGKAGRSRWLGRRPSVRG
FT                   VVMNPHDHPHGGGEGRKPAGRHPVTPWGQRTIGKKTRKSKKSDELIIRRRNEEKQE"
     atggcaatta agacatttaa accgacatca ccgtctagaa gatatatgac tgtagatact        60
     tttgaagaag ttacaactga tgaatcggaa aagtctctac tggctccact aaagaagagt       120
     ggaggacgta atgtaaatgg tcgtattact tcccgacggc gcggtggcgg acataaacgc       180
     aagtatagga ttattgattt taaacgtgat aaagacggag ttccagctaa ggttgctacg       240
     attgagtatg atcccaatcg ttctgcctac attgcattat taaattatgc agatggggaa       300
     aagagatata tcttagctcc acggggaatt gaagttggag aaaagatcat gtccggtcct       360
     gaagcagaaa ttaagccggg aaatgcttta cagatgaagg atatgccggt aggtactatt       420
     attcataatt tagaactgca gccgggcaaa ggcggtcagt tggttcgttc agctggagca       480
     caggcaagac tgatggccaa agaagaacag tatgttcatg ttaatctacc ttcaggagag       540
     gtaagattga ttcctgccga atgtaaagca acagttgggc aggttggaaa tattgaacat       600
     gagaatatca cactcggaaa ggcaggacgc agccgttggt taggacgtcg tccaagtgtt       660
     cgcggtgtag ttatgaaccc acatgatcac ccacacggcg gtggagaagg taggaagcct       720
     gctggaagac atccggttac tccttggggt cagcgtacta tcggtaagaa gacgcgcaag       780
     tctaagaagt ctgatgaatt aattattcgt cggcgaaatg aagagaagca agaataa          837
//

If you have problems or comments...

PBIL Back to PBIL home page