(data stored in SCRATCH zone)

EMBL: CP002105.PE175

CP002105.PE175       Location/Qualifiers
FT   CDS_pept        186624..187022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0176"
FT                   /product="SSU ribosomal protein S8P"
FT                   /note="COGs: COG0096 Ribosomal protein S8; InterPro
FT                   IPR000630; KEGG: hor:Hore_01310 ribosomal protein S8; PFAM:
FT                   ribosomal protein S8; SPTR: B8D0D8 30S ribosomal protein
FT                   S8; PFAM: Ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11727"
FT                   /db_xref="GOA:D9QTG3"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/TrEMBL:D9QTG3"
FT                   /protein_id="ADL11727.1"
FT                   /translation="MSVTDSIADMLTQTRNANMMVKEKVDIPASNLKEEMARVLEEEGF
FT                   IKDYKRIETDAQGKIRLYLKYGANKEKVITGLKRISKPGLRVYVDKNEIPQVLGGLGIA
FT                   ILSTSQGVMTDKEARSRGIGGEVLCYVW"
     atgtctgtga cggattcaat tgcggatatg ttaacccaaa ctagaaatgc taatatgatg        60
     gtgaaagaga aagtcgatat tcctgcctct aatttaaaag aagaaatggc ccgggtttta       120
     gaagaggaag gatttattaa agactataaa cgaattgaaa ctgatgctca ggggaaaata       180
     agactttatt taaagtatgg agctaataaa gaaaaagtaa ttactggttt gaagcgaatc       240
     agtaagccag gacttagagt ttatgtcgac aaaaatgaga ttcctcaggt gttaggcgga       300
     cttggaattg ctattctgtc tacatctcag ggagtcatga ctgataaaga agcacgcagc       360
     cgaggaatcg gtggagaagt actctgttat gtatggtaa                              399
//

If you have problems or comments...

PBIL Back to PBIL home page