(data stored in SCRATCH zone)

EMBL: CP002105.PE177

CP002105.PE177       Location/Qualifiers
FT   CDS_pept        187632..187982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0178"
FT                   /product="LSU ribosomal protein L18P"
FT                   /note="COGs: COG0256 Ribosomal protein L18; InterPro
FT                   IPR005484:IPR004389; KEGG: hor:Hore_01330 ribosomal protein
FT                   L18; PFAM: ribosomal protein L18P/L5E; SPTR: B8D0E0
FT                   Ribosomal protein L18; TIGRFAM: ribosomal protein L18;
FT                   PFAM: Ribosomal L18p/L5e family; TIGRFAM: ribosomal protein
FT                   L18, bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11729"
FT                   /db_xref="GOA:D9QTG5"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/TrEMBL:D9QTG5"
FT                   /protein_id="ADL11729.1"
FT                   /translation="MSTSRKKRHQRIRNKISGTPFKPRLSVYRSLKHIYAQLIDDLSGE
FT                   TLAAASTQDPEIRDEIDNGGNVEAAQMVGELIAERALKEDIKEVVFDRGGNKYHGRVKA
FT                   LAEAARENGLEF"
     atgagcacaa gtagaaagaa acgccatcaa aggattcgaa ataaaattag tggaactcct        60
     tttaaacctc gattaagtgt ttatcgtagt ttaaagcata tttatgccca attaatcgat       120
     gacttatccg gtgaaacatt agctgcagct tctactcaag atcctgaaat tagagatgag       180
     atcgataatg gtggaaatgt agaagcagct cagatggtag gagaactaat agctgaacgt       240
     gccttaaaag aagatattaa agaagttgtc tttgaccgcg gaggcaataa atatcatggt       300
     cgagtaaaag ctttagctga agcagctaga gaaaacggtt tggaatttta a                351
//

If you have problems or comments...

PBIL Back to PBIL home page