(data stored in SCRATCH zone)

EMBL: CP002105.PE198

CP002105.PE198       Location/Qualifiers
FT   CDS_pept        202470..203459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0199"
FT                   /product="Radical SAM domain protein"
FT                   /note="COGs: COG1180 Pyruvate-formate lyase-activating
FT                   enzyme; InterPro IPR007197:IPR013785:IPR006638:IPR016431;
FT                   KEGG: mta:Moth_2294 radical SAM family protein; PFAM:
FT                   Radical SAM domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB; SPTR: Q2RG58 Radical SAM; PFAM: Radical SAM
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11750"
FT                   /db_xref="GOA:D9QTI6"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016431"
FT                   /db_xref="InterPro:IPR027596"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:D9QTI6"
FT                   /protein_id="ADL11750.1"
FT                   /translation="MKEARWYERLDEEEIRCNLCPHSCLITAGQTGICQARENQEGRLV
FT                   SKTYGQVSAVAVDPIEKKPLFHFYPGSEILSLGTVGCNLRCQFCQNYHIAHNQEAETRR
FT                   LEPEEIVTLVKKHNSIGAAYTYSEPLIWYEYILDTAQLIHQTGLKNVLVTNGLINPEPL
FT                   AGLLSYIDGLNIDLKAFSEEFYRDICQGYLEPVKESIRLANQEALVEVTTLLIPGLNDS
FT                   REEIEELTAWLADINPDIPLHFTRYFPKYKLQAEQTSMETLLQAKEIAEEKLNFVYLGN
FT                   VREPEYSNTYCYECGQLLIKRSWSQPEIYLQDDICPECGAEINILLAD"
     atgaaggaag cccgatggta tgaaaggtta gatgaggaag agatacgctg caatctatgt        60
     ccccacagct gtcttataac tgctggccag acaggtatct gtcaggcaag ggagaatcaa       120
     gaaggaagat tagtcagtaa gacttatggc caggtcagtg cagtggcagt tgatcctatt       180
     gagaagaagc cgttatttca tttctatccc ggtagtgaga ttctatcctt agggactgta       240
     ggctgtaatt taagatgcca attctgccag aattatcata ttgctcataa ccaggaggct       300
     gagacaagaa gattagagcc tgaagagata gttactctag ttaaaaaaca taattctatc       360
     ggtgcagcct atacctattc ggagccattg atctggtatg agtatattct ggatacagct       420
     cagttaatac atcagacggg attaaagaat gtattagtaa ccaatggtct gattaatcct       480
     gagcccttgg ctggattatt gtcctatatt gatggtttaa atattgattt aaaagcattc       540
     agtgaagagt tttatcgtga tatctgtcag ggctatttag agccggttaa agagagcatt       600
     agactggcta atcaggaggc tttagtggag gtaactactc tattgatacc aggattgaat       660
     gattcaaggg aagagattga agaattaaca gcctggctgg ccgatattaa tcctgatatt       720
     ccgctccact ttactcgcta ctttcctaag tataaattac aggctgagca gacatcgatg       780
     gagactttgc tgcaggccaa ggagatagct gaagaaaagt tgaactttgt ttatctaggt       840
     aatgtaaggg agccggagta tagtaatact tattgttatg aatgtggtca actgcttatc       900
     aagcgaagtt ggtctcagcc ggaaatatac ttgcaagatg atatatgtcc agagtgtgga       960
     gctgagatta atattctgct ggcggattaa                                        990
//

If you have problems or comments...

PBIL Back to PBIL home page