(data stored in SCRATCH zone)

EMBL: CP002105.PE202

CP002105.PE202       Location/Qualifiers
FT   CDS_pept        206604..209474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0203"
FT                   /product="glycerol 3-phosphate dehydrogenase (quinone)
FT                   subunit C"
FT                   /EC_number="1.1.5.3"
FT                   /note="COGs: COG0277 FAD/FMN-containing dehydrogenase;
FT                   InterProIPR006094:IPR004113:IPR004017:IPR016167:IPR
FT                   012285:IPR016166:IPR016164:IPR009051:IPR017753; KEGG:
FT                   hma:rrnAC1967 glycolate oxidase subunit GlcD; PFAM: FAD
FT                   linked oxidase domain protein; protein of unknown function
FT                   DUF224 cysteine-rich region domain protein; SPTR: C1SJH5
FT                   FAD/FMN-dependent dehydrogenase; TIGRFAM:
FT                   glycerol-3-phosphate dehydrogenase, anaerobic, C subunit;
FT                   PFAM: Cysteine-rich domain; FAD binding domain; FAD linked
FT                   oxidases, C-terminal domain; TIGRFAM: glycerol-3-phosphate
FT                   dehydrogenase, anaerobic, C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11754"
FT                   /db_xref="GOA:D9QTJ0"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D9QTJ0"
FT                   /protein_id="ADL11754.1"
FT                   /translation="MTNLKLEEQMDELNSLIDGEVLTDETNRILYSTDASIYQIEPLGV
FT                   VLPKNKSDVQKAVEYASNNGLSIIPRGAGSGLSGQTLGQGIVIDFTKYMDRIKEINIEE
FT                   SYVRLEPGVTLGVLNQTLSQDNKFLPPDPSSGNYCTLGGMLGNNASGGHSVKYGSTIDY
FT                   VLELEVVLADGEEIKVENLEIGSQQFKAKLNQSNKVGDIYQQILELVKNNKELIAEHTP
FT                   DARKNCSGYRLDEVLADQQFNLAKLLVGSEGTLAVITEAKLRIAELPSEQAIALLYFDD
FT                   LDKAGRAVDKVLELDPSAIEIMNYGFLELVRKNHADIDQRLPDDLKTALLIEFDGDSQS
FT                   EIEEKILQTEELICDELGLAFEIDTAHEEAEQKKLWSVRKSAVPILNKLEGPKRITGFV
FT                   EDVAVAPAKLPDYIRRFKEIMDKYEVEAIIYGHAGHGNTHPRPLLNLKQEEDIEKMEAI
FT                   AQDVYELVNELNGTISGEHGDGLLRTDFIEEIYGSMYDLFQKTKEIFDPEYILNPGKIV
FT                   VDTTDLLTENLRYGADYETIGVESDLEFATEYQKEVEKCHGCSKCRSVVGTDMCPVFKA
FT                   LGEEKAAPRAKANILRGLISGRLDYNEYLKSRAFQEVFDLCLNCKNCYLECSSEVNIPK
FT                   LIMEARIQHYRQTGQPLVNRFLGASEVLGKLGSITPKLTNTFLDAAPLRGMMEKMTGIA
FT                   KKRSLPEFTDNTFKEWFAGRENKADKKVAYFVGCSTNYYHPEVGKGLVQLLEANGYQVI
FT                   IPDQKCCSVANLNYGNLEGVQENINYNLESLVEVVKEGYDIVADCPSCSLMLKEEQLDV
FT                   VDTKEARLVAENTYHINEYLLNLKEKDELKLDFNPNEIDFLYHTPCHLKAQGLASSTEE
FT                   LLGFIPELEIKELDAGCCGIAGTFGLKKDKYDLSMEIGENLFKKIESSNLEKVLTDCDA
FT                   CRMQLEEGTGKAVRHPIEILAENLSD"
     atgaccaatt taaaattaga agagcagatg gatgaactga attcgttaat tgatggtgag        60
     gtgctgactg atgaaacaaa tcgtattctg tatagtaccg atgccagtat ttatcagatt       120
     gagccgttag gagtagtctt acctaagaat aaatctgatg tacagaaggc tgtagagtat       180
     gcttctaata atggtttatc gattatacct agaggagccg gctctggttt atcaggtcaa       240
     actttgggtc aaggaattgt aatagatttt actaagtata tggatagaat taaagagatt       300
     aatatagaag aatcctatgt tcgactagaa ccgggcgtta ctttaggtgt tttgaatcag       360
     actttaagtc aagataataa attcttgccg cctgatcctt ccagtggtaa ttactgtact       420
     ttaggcggta tgctgggtaa taatgcttca ggcggacatt cagttaagta cggcagtact       480
     attgattatg ttctggaatt agaagtagtg ctggctgatg gagaagaaat taaagtggag       540
     aacttggaga taggaagcca gcagtttaaa gcgaaactga atcagtccaa taaagtgggg       600
     gatatttacc agcagatcct tgaattggtt aaaaataata aagaattaat tgctgaacat       660
     actccagatg ctagaaagaa ctgtagcggc tatagattgg atgaggtttt ggctgatcag       720
     cagtttaatt tagcaaagtt attggttggt tcggaaggga ctttagctgt gattactgaa       780
     gctaaattaa gaattgctga actgccttca gagcaggcaa tagctctgtt atactttgat       840
     gatctggata aggcaggtag agctgtagat aaggttttag aactggatcc cagtgctatt       900
     gagattatga attatggctt tttggaactg gtacgcaaga atcatgctga tatcgaccag       960
     cggctgccgg atgatctcaa gacagcatta ttaatagagt ttgacggtga tagccagtct      1020
     gaaattgaag agaaaattct acagacagaa gagctaatct gtgatgaatt gggtttagcc      1080
     tttgaaatag atactgctca tgaggaagct gaacagaaga aattatggtc tgttagaaag      1140
     tcagcagttc cgattttaaa taagttagaa ggcccgaagc ggattacagg ctttgttgaa      1200
     gatgtggcag ttgctcctgc aaaattacct gactatatcc gccggtttaa agaaattatg      1260
     gataagtatg aagttgaagc aattatctac ggacatgccg gccatggaaa tactcatccc      1320
     cgtccgttat tgaatctgaa gcaagaagaa gatatcgaaa agatggaggc cattgctcag      1380
     gatgtttatg agttagtcaa tgagttgaat ggaactatca gtggagaaca cggtgatggt      1440
     ctgctgcgga cagactttat agaagagatt tatggttcga tgtatgatct gtttcagaaa      1500
     acaaaggaga tctttgatcc tgaatatatt ctgaatccgg gaaagatagt tgttgatacc      1560
     accgatttat taacggaaaa tcttagatat ggtgctgatt atgaaactat tggagttgaa      1620
     tctgatttag aatttgctac tgaataccaa aaagaagtgg agaaatgtca cggctgttcg      1680
     aagtgccgct cagtagtagg tacagatatg tgtcctgtct ttaaagcttt aggagaggaa      1740
     aaagcggctc caagggcgaa ggctaatata ctgcgggggc ttatttcagg cagactggat      1800
     tataatgaat atttaaagtc acgggccttc caagaggtct ttgacctctg tcttaactgt      1860
     aaaaactgtt atttagaatg ttcatcagaa gttaatattc ctaaattgat aatggaagcc      1920
     aggattcagc attatagaca gactgggcag ccgttagtta atagattctt aggagcaagt      1980
     gaagtattgg gtaagctggg tagtattact cctaaactga ctaatacctt tcttgatgct      2040
     gctcctttaa gagggatgat ggaaaagatg accggaattg ctaaaaaacg cagcttacct      2100
     gaatttaccg ataatacctt taaggaatgg tttgcaggta gagagaataa agcagacaag      2160
     aaggtagctt actttgtggg ctgttcaaca aattattacc atccggaagt aggaaaaggt      2220
     ttagtacagc tgttagaagc aaatggctat caagtaatca ttccagacca gaaatgttgc      2280
     agtgtagcca acttaaatta tggtaatcta gaaggtgtcc aagagaatat caattataat      2340
     ctggaatctt tagttgaagt agtaaaggaa ggctatgata ttgtagctga ctgtcctagc      2400
     tgtagtctaa tgttaaaaga agaacagctg gatgtagttg ataccaaaga agccagatta      2460
     gtagccgaga atacttatca tataaatgag tatctgttaa acttaaaaga aaaggatgaa      2520
     ctgaaactgg actttaatcc taatgaaatt gactttttat accacactcc ctgtcatctt      2580
     aaggcccagg gcttagcgag ctctactgaa gagttgttag gttttattcc tgaactggag      2640
     attaaagaat tggatgctgg ctgctgtggt atagccggaa cctttgggtt aaaaaaggat      2700
     aagtatgacc tatcaatgga gataggtgag aatctattta agaagataga gagcagtaat      2760
     ttagaaaagg tattgactga ttgtgatgcc tgtcgaatgc aattagaaga aggaactggt      2820
     aaagcagtaa gacatccgat agagatttta gctgaaaatc ttagtgatta g               2871
//

If you have problems or comments...

PBIL Back to PBIL home page