(data stored in SCRATCH zone)

EMBL: CP002105.PE206

CP002105.PE206       Location/Qualifiers
FT   CDS_pept        214194..215183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0207"
FT                   /product="ketol-acid reductoisomerase"
FT                   /EC_number="1.1.1.86"
FT                   /note="COGs: COG0059 Ketol-acid reductoisomerase;
FT                   InterProIPR013116:IPR000506:IPR016040:IPR008927:IPR 013023;
FT                   KEGG: tpd:Teth39_0014 ketol-acid reductoisomerase; PFAM:
FT                   Acetohydroxy acid isomeroreductase catalytic domain
FT                   protein; acetohydroxy acid isomeroreductase; PRIAM:
FT                   Ketol-acid reductoisomerase; SPTR: C7IRE7 Ketol-acid
FT                   reductoisomerase; TIGRFAM: ketol-acid reductoisomerase;
FT                   PFAM: Acetohydroxy acid isomeroreductase, catalytic domain;
FT                   TIGRFAM: ketol-acid reductoisomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11758"
FT                   /db_xref="GOA:D9QTJ4"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR014359"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D9QTJ4"
FT                   /protein_id="ADL11758.1"
FT                   /translation="MKMYYDEDANLEYLEGRTVAVIGYGSQGHAQSQNLRDSGIDVIVS
FT                   ELEGTENYELAVEDGFDPVGAEEAAKEADVIQILLPDEVQKKVYYNDIEPHLEEGNALV
FT                   FSHGFNIHYKQIVPPENVDVYMVAPKGPGHLVRRVYKEGEGVPSLIAIYQDATGKAKDL
FT                   ALAHAKGVGGTRAGVIETTFKEETETDLFGEQAVLCGGVTELVKAGFETLTDAGYQPGI
FT                   AYFECLHELKLIVDLMYEGGLAKMRNSISDTAEYGDLIAGEKVINDKSREAMQELLDNV
FT                   KNGEFAKRWLLENQVGRPAYLKRKEIDANHQIEEVGKELREMMDWIED"
     atgaaaatgt attatgatga ggatgctaat ctggagtatt tagaaggaag aacagttgca        60
     gttataggtt atggtagcca gggccatgcc cagtcacaga acttaaggga ttctggtata       120
     gatgttattg tatctgaatt ggaaggaaca gagaattatg agttggcagt cgaggatgga       180
     tttgatcctg taggtgctga agaggctgct aaagaagcag atgtaattca gattttatta       240
     cctgatgagg tacagaagaa ggtctattat aatgatattg aacctcattt agaagaagga       300
     aatgcacttg tcttttctca cggatttaat attcactata agcagattgt gccgccagag       360
     aatgtagatg tctatatggt agctccaaaa ggaccgggac acttagttag aagagtctat       420
     aaagaaggcg aaggagttcc tagcttaatt gctatctatc aggatgctac aggtaaagct       480
     aaagatcttg cactggccca tgctaaaggc gttggcggta ctcgtgctgg cgtaattgag       540
     actacattta aggaagaaac tgagactgat ctctttggag aacaggcagt actctgcggc       600
     ggagtaactg aattggttaa agccggtttt gaaactctga cggatgcagg ctatcagccg       660
     ggaattgctt actttgaatg cttacatgaa ttgaaattaa ttgttgattt gatgtatgaa       720
     ggcggtctag ccaagatgag aaattctatt tctgatactg ctgagtatgg agacttaatt       780
     gctggtgaga aggtaattaa tgataagtcc agagaggcaa tgcaggagct tttagataat       840
     gttaagaatg gagaatttgc taagcgctgg ttgcttgaga atcaggtagg ccgtccagct       900
     tatttgaagc gtaaagagat tgatgctaat catcagattg aagaggttgg taaggagtta       960
     agagagatga tggactggat tgaagactaa                                        990
//

If you have problems or comments...

PBIL Back to PBIL home page