(data stored in SCRATCH zone)

EMBL: CP002105.PE208

CP002105.PE208       Location/Qualifiers
FT   CDS_pept        216775..218037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0209"
FT                   /product="3-isopropylmalate dehydratase, large subunit"
FT                   /EC_number="4.2.1.33"
FT                   /note="COGs: COG0065 3-isopropylmalate dehydratase large
FT                   subunit;
FT                   InterProIPR018136:IPR001030:IPR015931:IPR015932:IPR
FT                   011823:IPR011826:IPR006251; KEGG: hor:Hore_10870
FT                   3-isopropylmalate dehydratase, large subunit; PFAM:
FT                   aconitate hydratase domain protein; SPTR: B8CX22
FT                   3-isopropylmalate dehydratase large subunit; TIGRFAM:
FT                   3-isopropylmalate dehydratase, large subunit;
FT                   3-isopropylmalate dehydratase; homoaconitate hydratase
FT                   family protein; PFAM: Aconitase family (aconitate
FT                   hydratase); TIGRFAM: 3-isopropylmalate dehydratase, large
FT                   subunit; homoaconitate hydratase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11760"
FT                   /db_xref="GOA:D9QTJ6"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006251"
FT                   /db_xref="InterPro:IPR011823"
FT                   /db_xref="InterPro:IPR011826"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:D9QTJ6"
FT                   /protein_id="ADL11760.1"
FT                   /translation="MGMTMVEKILADHAGREEVQPGELINARLDIVLGNDVTTPVAIKE
FT                   FDKIGVDEVFDKERVVIVPDHFAPNKDINSAEQCKFIRGFAEEKELVNYFEIGEMGIEH
FT                   CLLPEQGLVLPGDAVIGADSHTCTYGALGAFATGVGSTDMAAGMATGEAWFKVPETIKF
FT                   VYNGELNDWVGGKDLILYTIGDIGVDGALYKAMEFTGEVIENLPMDHRFTMSNMAIEAG
FT                   GKCGLIEPDQTTIDYVEDRAQRDYKLYQSDEDAEYDEIIEYDVSQIEPQVAFPHLPENT
FT                   RGISEVGEVEIDQAVIGSCTNGRLGDLRLAAKVLEGKKAADNVRLIVFPGTQEIYKQAM
FT                   KEGLIETLIDAGAAVSTPTCGPCLGGHMGILAEGERAIATTNRNFVGRMGHPESEVYLS
FT                   NPAVAAASAIKGKIVSPKEVI"
     atgggaatga caatggtaga aaagatttta gctgaccatg ctggaagaga agaggttcag        60
     cctggagaat taattaatgc caggctggat attgttctcg gtaatgatgt aactactcct       120
     gtggccatca aggaatttga taagataggt gtagatgagg tattcgataa agaacgggta       180
     gtaattgtac ctgatcattt tgctcctaat aaggatatta attcagctga gcagtgtaag       240
     tttattagag gctttgctga ggagaaagaa ttagttaatt actttgaaat cggtgagatg       300
     ggaattgaac actgtctttt accggaacag ggtttagttc tgccggggga tgcagttatt       360
     ggagctgact cccatacctg cacttatggt gctctaggag cctttgctac tggtgtagga       420
     agtacagata tggccgccgg tatggctact ggtgaagcct ggtttaaagt accggagaca       480
     attaagtttg tctataatgg tgaactgaat gactgggtcg gcggtaaaga cttgattcta       540
     tatactatcg gtgatatcgg agtcgacggc gcattatata aggcaatgga gtttaccggt       600
     gaagtgattg agaatttacc gatggatcac cgctttacta tgtccaatat ggctattgag       660
     gccggcggta agtgcggttt gattgagccg gatcagacga ctatagatta tgtagaggat       720
     agagcccagc gtgattataa actctatcag agcgatgaag atgcagagta tgatgagata       780
     attgagtatg atgtcagcca gatagagcca caggtggcct tccctcattt acctgaaaac       840
     acaagaggta tcagtgaagt aggcgaggta gagatcgatc aggcggtaat cggttcctgt       900
     accaatggac ggcttggtga tctgcgtttg gctgctaagg tactggaagg aaagaaagca       960
     gctgataatg ttaggttgat tgtcttccct ggtacgcagg agatctataa gcaggctatg      1020
     aaagaaggct taatcgagac cttgattgat gctggcgctg ctgtcagtac accaacctgc      1080
     ggcccttgtt taggcggaca tatgggaatt ttagctgaag gtgaacgggc aattgcgact      1140
     actaaccgta actttgtggg ccggatgggc catccagaaa gcgaagtcta tctgtccaat      1200
     ccagcagtgg ctgcggcatc ggctatcaaa ggaaaaattg tcagtccgaa ggaggtaata      1260
     tag                                                                    1263
//

If you have problems or comments...

PBIL Back to PBIL home page