(data stored in SCRATCH zone)

EMBL: CP002105.PE209

CP002105.PE209       Location/Qualifiers
FT   CDS_pept        218038..218532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0210"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /EC_number="4.2.1.33"
FT                   /note="COGs: COG0066 3-isopropylmalate dehydratase small
FT                   subunit; InterPro IPR000573:IPR015928:IPR011824:IPR011827;
FT                   KEGG: csc:Csac_1332 3-isopropylmalate dehydratase small
FT                   subunit; PFAM: aconitate hydratase domain protein; SPTR:
FT                   A4XJ49 3-isopropylmalate dehydratase small subunit;
FT                   TIGRFAM: 3-isopropylmalate dehydratase, small subunit;
FT                   PFAM: Aconitase C-terminal domain; TIGRFAM:
FT                   3-isopropylmalate dehydratase, small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11761"
FT                   /db_xref="GOA:D9QTJ7"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR011824"
FT                   /db_xref="InterPro:IPR011827"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/TrEMBL:D9QTJ7"
FT                   /protein_id="ADL11761.1"
FT                   /translation="MELKGQAWKYGDDVDTDVIIPARYLNTSKPEELAKHCLEDLDEDF
FT                   VDKMKQGDMIVAEKNFGCGSSREHAPLAIKAAGVSCVIAKSFARIFYRNAINIGLPILE
FT                   SEAAVDGIGIEDEVEVDVESGEIKNLTKDEVYQAEPFPEFMQNIIQAGGLINYVAGKVN
FT                   N"
     atggaattaa aaggccaagc ttggaagtac ggtgatgatg tagatactga tgtgattatt        60
     ccggcccgtt atttgaatac ttcaaagcct gaagaactgg caaagcattg tcttgaagat       120
     ttagatgaag actttgtaga taagatgaag caaggagata tgatagttgc tgagaagaac       180
     ttcggctgcg gcagttcaag ggagcatgct cctttggcta tcaaagcagc aggtgtctct       240
     tgtgttatag ctaaatcttt tgctcgtatt ttttatcgga atgctatcaa tatcggactg       300
     cctattctgg agtctgaagc agcagtagac ggtattggta tcgaggatga agtagaggtt       360
     gatgttgaat cgggagagat taagaattta actaaagatg aagtctatca ggcggaacca       420
     tttcctgaat ttatgcagaa tatcattcaa gcaggcggtt taattaatta tgtagcaggg       480
     aaggtgaata attaa                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page