(data stored in SCRATCH zone)

EMBL: CP002105.PE218

CP002105.PE218       Location/Qualifiers
FT   CDS_pept        228675..230030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0219"
FT                   /product="PHP domain protein"
FT                   /note="COGs: COG0613 metal-dependent phosphoesterase (PHP
FT                   family); InterPro IPR004013:IPR016195:IPR003141; KEGG:
FT                   hor:Hore_11830 PHP domain protein; PFAM: PHP domain
FT                   protein; SMART: phosphoesterase PHP domain protein; SPTR:
FT                   B8CXB4 PHP domain protein; PFAM: PHP domain"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11770"
FT                   /db_xref="GOA:D9QTK6"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:D9QTK6"
FT                   /protein_id="ADL11770.1"
FT                   /translation="MRNVDLHLHTTASDGSYTPEELVEKAVGMGLETIAVTDHDTVGGV
FT                   APALTAAKEVDLEVIPGVEFTTYVGQEEVHILGYYFDYLDQNFLMELTKLKEARENRGK
FT                   KIVEKLNKLGLELEWKSVIEVAGSGAVGRPHIARALVNEGYVADVSAAFEDYLGDRGPA
FT                   YVPKTQLTPQDAIEAINEAGGVAVLAHPGHLSTNELIVEIIEAGIDGIEAYYSGHDEEE
FT                   TKQYIKLANRYDLIITGGSDCHGPKIKEGILLGTVDIPDNVIDNLKVAYRNRYNIESID
FT                   FKKYLKVYPETSGLYPEKLQEIGEKYHDKGYLTKEELYELAYLNSTRSSYHVKKNSPDR
FT                   VKKITEIVYNLADEFSQLTLLTGLLGVGIPTASAILTSLDEASHTVIDTRVWATLYQMG
FT                   YFDTKKESFSADDYIRIINIVRRLANETDLTTAEIGYALFAYDVEHREGTLH"
     atgaggaatg tggatttaca tttacatacg acagcttctg atggttccta tactccagag        60
     gagctggtag aaaaagcagt agggatggga ttagagacaa tagcagttac cgaccatgat       120
     acagttggcg gtgtggctcc ggctttaact gctgctaaag aagtggatct agaagtcatt       180
     cccggcgtcg aatttactac ttacgtcggt caagaagagg tccatatttt aggttattac       240
     tttgattatc ttgatcagaa ttttttaatg gaattaacta agctgaaaga agcccgcgaa       300
     aatcggggta agaagatagt tgagaagttg aataaattag gcttagagct tgagtggaaa       360
     tcagtaatag aggtggccgg ttcaggtgct gtaggtaggc cgcatattgc ccgggcttta       420
     gtcaatgaag gctatgtagc ggatgtatct gctgcctttg aggattatct cggtgaccgc       480
     ggaccggctt atgtccccaa gacacagctt acgccccagg atgcaattga ggctatcaat       540
     gaagcaggcg gtgttgccgt tttggcccat cctggccatc tatcgactaa tgagttaata       600
     gttgagatta tagaagccgg cattgatggt atcgaagctt attattccgg ccatgatgaa       660
     gaggaaacta aacagtatat caagttagca aatcggtatg atctaataat caccggaggc       720
     tctgactgcc atggtcccaa gattaaggaa ggtattctgc tggggactgt tgatattccg       780
     gataatgtta tcgataactt aaaggtagcc tataggaata gatataatat tgagtcgata       840
     gattttaaaa agtacttaaa ggtatatcct gagacttcag gtctatatcc tgagaagctg       900
     caggaaatag gggagaagta tcatgataaa ggatatttaa ctaaagaaga attatatgaa       960
     ctggcttatc tgaattctac ccgcagttct tatcatgtca agaagaattc tccggatcgc      1020
     gtaaagaaaa taaccgagat tgtctataac ttagctgatg aattttctca gctgacactc      1080
     ttaaccgggt tactgggagt aggaattcca acagcttcag caatcttaac cagtctagat      1140
     gaggccagcc atacagtaat agataccaga gtctgggcga ctctctatca aatgggttat      1200
     ttcgatacca aaaaggaatc ttttagtgcc gatgattata tcagaattat caatattgta      1260
     agaagattag ctaatgagac ggacttaacc acagctgaga tcggttatgc tctttttgct      1320
     tatgatgtag aacaccgcga aggaactctc cattaa                                1356
//

If you have problems or comments...

PBIL Back to PBIL home page