(data stored in SCRATCH zone)

EMBL: CP002105.PE220

CP002105.PE220       Location/Qualifiers
FT   CDS_pept        231212..231808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0221"
FT                   /product="hydrolase, HAD-superfamily, subfamily IIIA"
FT                   /note="COGs: COG0241 Histidinol phosphatase and related
FT                   phosphatase; InterPro IPR005834:IPR006543:IPR006549; KEGG:
FT                   gsu:GSU2084 HAD superfamily hydrolase; PFAM: Haloacid
FT                   dehalogenase domain protein hydrolase; SPTR: Q74BF7
FT                   Hydrolase, HAD-superfamily; TIGRFAM: hydrolase,
FT                   HAD-superfamily, subfamily IIIA; histidinol-phosphate
FT                   phosphatase family protein; PFAM: Polynucleotide kinase 3
FT                   phosphatase; TIGRFAM: haloacid dehalogenase superfamily,
FT                   subfamily IA, variant 3 with third motif having DD or ED;
FT                   D,D-heptose 1,7-bisphosphate phosphatase; HAD-superfamily
FT                   hydrolase, subfamily IIIA; histidinol-phosphate phosphatase
FT                   family domain"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11772"
FT                   /db_xref="GOA:D9QTK8"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D9QTK8"
FT                   /protein_id="ADL11772.1"
FT                   /translation="MKDLADIAVFMDRDGTVSKEIGYVNHGDRFELLPRTSAAVKLLNN
FT                   VGIKAILATNQAGVARGYFPEERINEVHDKLKQLLAEDEAYLDAIYYCKHHPDVGEGEY
FT                   NKDCNCRKPKPGMLKEAAKDFDLDLEESYMIGDKISDIEMAKRVGATGILVLTGYGQGV
FT                   YEYEQQDWPVEPDYIADDLFDAVDWILKEQGIWKR"
     atgaaggatt tagctgatat agcagtcttt atggatcgtg atgggacagt aagtaaggag        60
     ataggctatg ttaatcatgg tgatcggttt gaattactgc cgcggaccag tgctgctgtt       120
     aaactgttga ataatgtagg aatcaaggct attctggcta ctaatcaggc tggggtagct       180
     cggggatatt ttccggaaga gaggattaat gaggtacatg ataaactaaa gcagctttta       240
     gcagaggatg aggcttatct ggatgctatc tattactgca agcatcatcc tgatgtcggt       300
     gaaggcgagt acaataaaga ctgcaactgc cggaagccta aacccggtat gttaaaggaa       360
     gcagctaaag attttgattt agacctggaa gaatcttata tgattggtga taagatcagc       420
     gatatagaga tggctaaacg ggtgggagca acagggattc tagttctgac cggttacggt       480
     cagggagtct atgagtatga gcagcaggac tggccggtag agccggatta tatagcagat       540
     gatctatttg atgctgtaga ctggatctta aaggagcaag gtatatggaa gagatag          597
//

If you have problems or comments...

PBIL Back to PBIL home page