(data stored in SCRATCH zone)

EMBL: CP002105.PE231

CP002105.PE231       Location/Qualifiers
FT   CDS_pept        243284..244120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0233"
FT                   /product="Flp pilus assembly protein CpaB"
FT                   /note="COGs: COG3745 Flp pilus assembly protein CpaB;
FT                   InterPro IPR013974:IPR017592; KEGG: pth:PTH_1449 flp pilus
FT                   assembly protein CpaB; PFAM: SAF domain protein; SPTR:
FT                   A5D2B5 Flp pilus assembly protein CpaB; TIGRFAM: Flp pilus
FT                   assembly protein CpaB; PFAM: SAF domain; TIGRFAM: Flp pilus
FT                   assembly protein CpaB"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11783"
FT                   /db_xref="GOA:D9QTL9"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR017592"
FT                   /db_xref="InterPro:IPR031571"
FT                   /db_xref="UniProtKB/TrEMBL:D9QTL9"
FT                   /protein_id="ADL11783.1"
FT                   /translation="MNFKVVIVIAVILGLITSGAVYFMMDNMQQEAVKEQPKASVVVAK
FT                   QNIEPREQITRSKVQLKQVPQETVHSQAVTSISQAVEKFALKDIISGEQLLKPRLLGKE
FT                   EVSSGLAFNLADDKRAVTVPVTEVSGVAGFLTPGDYVDVVSVFSTYEAQQTVAKTVLQK
FT                   VKVLAVAQDMVRERDQKPKVTKSVTLGVGLAEAEKLVLADRKGEIRLVLRSAQNESFSM
FT                   SNGVKFEELVGNLEEEGTDNKEQIADKDINQKSSSQDQEGIEVIRGSERSYQKVSP"
     gtgaatttta aagtagtcat agttatagct gtgattttag gattaattac ttccggagca        60
     gtttacttta tgatggataa tatgcagcag gaggctgtta aggagcagcc taaggcttcc       120
     gtggtagtgg ctaaacagaa tattgagcct cgggaacaga taacaaggag taaggtccag       180
     cttaaacagg tgccccagga aacagttcat tcacaggctg taacttccat ttctcaggca       240
     gtagaaaagt ttgccctgaa ggatattatt agcggagaac agcttctaaa gccgcggctg       300
     ttgggtaaag aagaagtaag ttcagggctg gcctttaatt tagcagatga taagcgggct       360
     gtaacagtgc cagtaactga agtatcagga gtagccgggt ttttgactcc gggtgattat       420
     gtcgatgtag tcagtgtttt cagtacctac gaagctcaac agacagtggc caaaacagta       480
     ctacagaagg tgaaggtttt agctgtagcc caggatatgg tgcgtgagag ggaccagaag       540
     cctaaggtaa ctaaaagtgt tactcttggt gttggtttag ctgaggcaga aaaactggtt       600
     ttagcagata gaaaaggcga aatcagatta gttctccgtt cggcccagaa tgaaagcttt       660
     tctatgagca atggagttaa gtttgaggaa ttagtaggaa acttagagga agaaggaaca       720
     gataataaag agcaaatagc agataaagat attaaccaga aatcaagcag tcaggatcaa       780
     gaaggaatag aggttattcg aggcagtgaa aggagttatc agaaagtatc gccgtag          837
//

If you have problems or comments...

PBIL Back to PBIL home page