(data stored in SCRATCH zone)

EMBL: CP002105.PE247

CP002105.PE247       Location/Qualifiers
FT   CDS_pept        261064..261624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0249"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: oih:OB2505 hypothetical protein; SPTR: B4BNA2
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11799"
FT                   /db_xref="UniProtKB/TrEMBL:D9QTN5"
FT                   /protein_id="ADL11799.1"
FT                   /translation="MKLRLEINQRLAKIGLRTTPPQTSVKQKPAEVKQKTVNGELKIES
FT                   KPVKVKIDQKKARAALNYKHYKIYGKDIAKRGKQTALKAIAEYSSQGDQLARIEKKGKP
FT                   LIAQAKKNAYGDKKKVGLKWKPGPEISVTPGQQDINFEVKDLNGIKLDTEPNWPQIDLQ
FT                   WGKVEAYQKQKAELEIKAVDKKV"
     atgaagttaa ggttagagat taatcagagg ctggctaaga ttggtctgcg gacaactccg        60
     cctcaaacaa gtgttaaaca gaagccggct gaagttaagc agaaaacagt gaatggagag       120
     ttgaagattg agtctaagcc tgttaaagta aaaattgatc agaagaaagc acgggctgct       180
     ttgaattata aacattacaa gatttatggt aaggatatag ctaaacgagg gaagcagaca       240
     gctttaaaag ctatagctga atactctagt caaggagatc aattagcaag gattgaaaag       300
     aaaggtaagc ctttaattgc tcaggctaaa aagaatgcct atggtgataa aaagaaagta       360
     ggattgaaat ggaagccggg acctgaaatc agtgttactc ctgggcaaca ggatattaat       420
     tttgaagtca aggatttaaa tgggattaaa ttagatacag aacctaactg gccgcagatt       480
     gatttacagt gggggaaggt tgaagcatat caaaagcaga aagctgaatt agagattaaa       540
     gctgttgata aaaaagtgta a                                                 561
//

If you have problems or comments...

PBIL Back to PBIL home page