(data stored in SCRATCH zone)

EMBL: CP002105.PE251

CP002105.PE251       Location/Qualifiers
FT   CDS_pept        264185..265930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0253"
FT                   /product="flagellar hook-associated 2 domain protein"
FT                   /note="COGs: COG1345 Flagellar capping protein; InterPro
FT                   IPR003481:IPR010810:IPR010809; KEGG: mta:Moth_0765
FT                   flagellar hook-associated 2-like; PFAM: flagellar
FT                   hook-associated 2 domain protein; flagellar hook-associated
FT                   protein 2 domain protein; flagellin hook IN repeat protein;
FT                   SPTR: Q2RKF6 Flagellar hook-associated 2-like; PFAM:
FT                   Flagellar hook-associated protein 2 C-terminus"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11803"
FT                   /db_xref="GOA:D9QTN9"
FT                   /db_xref="InterPro:IPR003481"
FT                   /db_xref="InterPro:IPR010809"
FT                   /db_xref="InterPro:IPR040026"
FT                   /db_xref="UniProtKB/TrEMBL:D9QTN9"
FT                   /protein_id="ADL11803.1"
FT                   /translation="MADLSLDGLASGMPTENTINQILNAEYGTKLQNLNQEKSNLETQK
FT                   NAWRDVNSRIDKLEQKVTQLKLSSTFASNKTTSSDEEVVTATSTTDATEGTYDIEVVKK
FT                   ALAHRIAGTDQSAKIDSATSANSEDISEIAMQNGGEYTATQFSSGETIDGTTYDYGLKN
FT                   SDGNIVAVSTNQQVYTSLDKATAEGDLGSLTSSNLGESYDFGSAIANNTVVRMDGTGAN
FT                   EKNNLATAIMMNDDTVTINGTDISVSATDTLEDFVIAVNDSDAGVNASTVSNRLILESN
FT                   ETGTDNEITLSDNGNSNGQHLLEDLGLIDGSDNIITSNDGYQAAQNAEVTVNGITGITS
FT                   QDNTIDEAVSNVTFEISDAAQPSQETETATVTVSQDTEKATSKIQAFVDQYNSVQDFMN
FT                   KKLDYNSETEESGALQGDGTLMRLQSRLRQLVMEQVDSGNEYNSLMSVGISSKKNGTLE
FT                   FDSGKFETALKEKPEQVKNLFTSEEDDGSFDGVATKLDSYLDMVIQTNIGVIPGKIDSY
FT                   ERMMEDVEQSIASTNDRLEQERERLTQEFTSMEQSISEMNNQMSWMQSQLGSMGGTSNM
FT                   LSSMM"
     atggctgatt tgagtttgga tggtttggcc agtggaatgc cgactgaaaa tacgattaat        60
     cagatattaa atgcagagta tggaacaaag ttgcagaatt taaatcagga aaagagtaat       120
     ttggaaacac aaaagaatgc ctggcgggat gttaattcta gaatagataa gttagaacaa       180
     aaggtaacac agttaaaatt gtcttctact tttgcgtcta acaagacaac aagtagtgat       240
     gaagaagtag ttactgctac ttctactaca gatgctactg aaggcactta tgatatagag       300
     gtagtaaaga aagctctagc tcatagaata gctggaacag atcagtctgc taaaatcgat       360
     agtgctactt ctgctaatag tgaggatatt tctgagatag ctatgcagaa tgggggagaa       420
     tatacagcaa cccagtttag ttcaggggaa acaattgatg gtacaactta tgattatggt       480
     ttgaaaaata gtgatggaaa tattgttgct gtgagtacta accaacaagt ctatacttcc       540
     ttagataagg caactgccga aggggatttg ggcagtttaa cttcttcaaa tttaggtgag       600
     agttatgatt ttggttctgc gatagctaat aatacagtgg taaggatgga tgggactggg       660
     gctaatgaaa agaataattt agcaactgca attatgatga atgatgatac agtaactatt       720
     aatggtactg atattagtgt gtctgcgact gatactcttg aagattttgt gattgcagtt       780
     aatgatagcg atgctggtgt taacgctagt actgtatcta atcggttaat actagaaagt       840
     aatgaaacgg gaacagataa tgaaattact ttatctgata atgggaatag taatggacag       900
     catttattgg aagacttagg tcttatcgac ggtagtgata atattattac tagtaatgat       960
     ggttatcaag cggcacaaaa tgctgaagta actgttaatg ggattactgg cattacaagt      1020
     caggataata ctattgatga agcagtaagt aatgttactt ttgaaattag tgatgctgct      1080
     caaccttcac aagagacaga aacagctact gttactgtca gtcaagatac tgagaaagct      1140
     acttctaaaa ttcaggcttt tgttgaccaa tataatagtg tgcaggattt tatgaataaa      1200
     aagcttgatt ataattcaga gactgaggaa agcggtgcat tacaagggga tggaacctta      1260
     atgcgtctac agtctaggtt acggcagtta gtaatggaac aagtagatag cggtaatgaa      1320
     tataatagtt tgatgtcagt tggaattagt agtaagaaaa atggaacact tgaatttgat      1380
     tcaggcaaat tcgaaactgc tttgaaagaa aagccggagc aggtgaaaaa tctctttact      1440
     agtgaagaag atgatggttc ttttgatggg gtagctacta aattagatag ctatttagat      1500
     atggtgatcc aaactaatat aggagtaatt cctgggaaaa tagattctta tgaaagaatg      1560
     atggaggatg tggagcaaag tattgcatct acaaatgatc gattggagca ggagagagaa      1620
     agattaactc aggagtttac atctatggag caatctattt cagaaatgaa taatcagatg      1680
     agttggatgc agagtcaact gggcagcatg ggcggaacaa gtaatatgtt aagttctatg      1740
     atgtaa                                                                 1746
//

If you have problems or comments...

PBIL Back to PBIL home page