(data stored in SCRATCH zone)

EMBL: CP002105.PE253

CP002105.PE253       Location/Qualifiers
FT   CDS_pept        268254..270620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0255"
FT                   /product="Methyltransferase type 11"
FT                   /note="COGs: COG2226 Methylase involved in
FT                   ubiquinone/menaquinone biosynthesis;
FT                   InterProIPR001579:IPR001296:IPR013216:IPR011990:IPR 013026;
FT                   KEGG: fno:Fnod_1483 methyltransferase type 11; PFAM:
FT                   Methyltransferase type 11; glycosyl transferase group 1;
FT                   SPTR: A7HN43 Methyltransferase type 11; PFAM:
FT                   Methyltransferase domain; Glycosyl transferases group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11805"
FT                   /db_xref="GOA:D9QTP1"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D9QTP1"
FT                   /protein_id="ADL11805.1"
FT                   /translation="MDYNKINKLINQGQFDQAEKEIRKIKEETKKNNFFGLLNYHNNKF
FT                   EIARNYFEKGLERNPMDMELLYNYGCCLKDLGEDMEAWRYFMRISNKDYKVYDHLGDIE
FT                   YQNRSKVAAIKFYKKAFELSQFKEIETKYNEVRNLMKKNTKIVFLTVPGIGWGFIDNKV
FT                   EALSLIYDVKFVVSTDGEEIKEAVEWADIVWLEWANEMAVHVTNNVSSIKDKKVICRLH
FT                   GYEVFSDYGKKINFNYIDKMIFVAEHKKELLIEKYGELIDEEKIEVIRNGVDLDQFYIP
FT                   ENKKKNKKIALVGNINYRKGLLLLLNHFHELLKVDNEYKLFIRGEHQDFRYKMAIETMI
FT                   EELGLEDNIEFIFERVDDINKWLEDKSYIISASVEESFHYALAEGMAAGLQPVIHAWRE
FT                   SRDIWPGKYIFKETEEFKKLFLERELTPLEYREYIENNYSLENQLYEVEKIISKLLETK
FT                   TTKGIKQDYNSLNKVNRTDAVQLINNFIPYSEQFFSNISFDKLNLVTLKAEKIQEKLFH
FT                   LEMLLANKNNNIFIQNVIFNKNVNSLQIPNNYKKIKPLIKKIVNGLDFNFEQDIKTYIY
FT                   DEDLKNHIESNFKNYLWERAYPGTQFMRFHGELRIVCYYTFAEDLVKNKKVLEAASGFG
FT                   YGAAYFSKYAKEVTALDILEENLDWGKKTFGFNNVNWKQGDVTNLPFEDNSFDIYTSYE
FT                   TIEHLKSKDIISYLKEAKRVVKDKGIFLLSTPNKRVREGKIDNPFHISEMYFKEFNEFL
FT                   QEVFEEIEYYSYQEFKIHPGVKENSAENFIAICKV"
     atggactata acaaaattaa taaattaata aaccaaggac aatttgatca ggcagaaaaa        60
     gagataagaa aaataaaaga agagactaag aaaaataatt tttttggatt attaaattat       120
     cataataata aatttgaaat agctagaaat tattttgaaa aaggattgga aagaaatcca       180
     atggatatgg agctcttgta taattatgga tgttgtttga aggatttagg agaagatatg       240
     gaagcttggc gttattttat gagaatttct aataaagatt ataaagttta tgaccattta       300
     ggggatattg aatatcaaaa tagaagtaaa gttgctgcaa ttaaatttta taaaaaagct       360
     tttgaattga gtcaattcaa ggaaatagaa actaaatata atgaagtaag aaacttaatg       420
     aaaaagaata ctaaaatcgt atttcttacg gtacctggta taggctgggg atttattgat       480
     aataaagtag aagctttgtc tttgatttat gatgtaaagt ttgtagtttc aactgatgga       540
     gaagaaataa aagaagcagt tgaatgggcg gatattgttt ggttagaatg ggctaatgaa       600
     atggcagttc acgtaacaaa taatgtttca tctataaaag ataaaaaagt tatttgtagg       660
     ttgcatggtt atgaagtgtt tagtgattat ggtaaaaaaa taaattttaa ttatatagat       720
     aaaatgattt ttgtagctga acataagaaa gagcttctta ttgaaaaata tggagaatta       780
     atagatgaag aaaaaattga agttataaga aatggtgtag atttagatca attctatata       840
     ccagaaaata aaaagaaaaa taagaagata gctttagtag gaaatattaa ttatagaaaa       900
     ggtttattat tattattaaa tcactttcat gagttattaa aagtagataa tgaatataaa       960
     ttatttattc gaggggaaca tcaagatttc agatataaaa tggctataga gactatgatt      1020
     gaagagttag gattagaaga taatatagaa tttatatttg aaagagttga tgacataaat      1080
     aaatggttag aagataaatc atatattatt tctgcttctg ttgaggaatc atttcattat      1140
     gcattagcag agggaatggc agctggctta cagccggtta tacatgcttg gcgagaaagt      1200
     agagatatat ggcctggtaa atatatattt aaggaaaccg aagaatttaa aaagcttttt      1260
     ttggaaagag aattaactcc attagaatat cgtgagtaca ttgaaaataa ttattctttg      1320
     gaaaatcaat tatacgaagt agaaaaaata ataagtaaat tattagaaac aaaaactact      1380
     aaaggcatta aacaagatta taattcacta aataaagtta atcgaacaga tgctgtacaa      1440
     cttattaata attttattcc atattctgag caatttttta gtaatatatc ttttgataaa      1500
     ttgaatttag taactttaaa agcggaaaaa atacaggaaa aattatttca tttagaaatg      1560
     ttactggcaa ataaaaacaa taatatattt attcaaaatg ttatttttaa taaaaatgtt      1620
     aattcacttc aaattccaaa taattataaa aaaattaagc cattaattaa aaagatagtt      1680
     aatggattag attttaattt tgaacaagat attaaaacat atatatatga tgaagattta      1740
     aagaatcata tagaaagtaa ttttaaaaat tatttatggg agagggcata tcctgggaca      1800
     caatttatga gatttcatgg agaattaaga atagtttgtt attatacatt tgcagaagac      1860
     ttagtgaaaa ataaaaaagt tttagaggct gcttctggat ttggttatgg agctgcttat      1920
     ttttcaaaat atgctaagga ggtaactgct ttagatattc ttgaagaaaa cttagattgg      1980
     ggaaagaaaa cttttgggtt caacaatgtg aattggaaac aaggagatgt aactaattta      2040
     ccttttgaag ataatagttt tgatatttat acatcttatg aaacaattga acatttaaaa      2100
     agtaaagata taataagtta cttaaaggaa gctaagaggg ttgttaaaga taagggtatc      2160
     tttttattat ctactcctaa taaaagagtt cgagaaggaa aaatagataa tccatttcac      2220
     atttccgaaa tgtattttaa agaatttaat gagtttttac aagaggtttt tgaagaaatt      2280
     gaatattatt cgtatcagga atttaaaatt catccaggag taaaggaaaa tagtgcagaa      2340
     aattttattg ccatatgtaa agtataa                                          2367
//

If you have problems or comments...

PBIL Back to PBIL home page