(data stored in SCRATCH zone)

EMBL: CP002105.PE257

CP002105.PE257       Location/Qualifiers
FT   CDS_pept        273420..273995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0259"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hor:Hore_17050 hypothetical protein; SPTR:
FT                   B8CYT5 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11809"
FT                   /db_xref="UniProtKB/TrEMBL:D9QTP5"
FT                   /protein_id="ADL11809.1"
FT                   /translation="MEVYINEDQLEGVSGDIEEIISNVHSRLDREIVEQIYLNDMRVNE
FT                   DLLLSSDFEFDEESILKFETKEVNQLIEETLSEIDMYLPKLKEGVINTAQLFRQEKLEK
FT                   GRAKYESCLEGLEWYINVLQNILSLLDSEELTKQGEEILIEFNKRLRDVMKKMQIKDFD
FT                   SAADLLEDEIVDYIGQFNELNDKLTNVK"
     gtggaagtat acataaatga ggaccaacta gaaggagtat caggtgatat tgaagaaatc        60
     ataagtaatg ttcattctag attggataga gaaattgtag aacagattta tttaaatgat       120
     atgagagtta atgaagattt actattgagt agtgattttg agtttgatga agagtctata       180
     ttaaaatttg aaactaaaga agttaatcaa ttaatagaag aaactttatc ggagattgat       240
     atgtatttac ctaagcttaa agagggagtt ataaatactg ctcaattatt tcgacaggaa       300
     aaactagaaa agggtagagc aaaatatgag tcctgtcttg aaggcttgga atggtatatt       360
     aatgtattac aaaatatttt atcactactt gatagtgaag aattaacaaa gcagggagaa       420
     gaaatattga tagagtttaa caaaaggtta agagatgtaa tgaagaaaat gcaaattaaa       480
     gattttgatt cagcggctga tttattagag gacgaaattg ttgattatat tgggcagttt       540
     aatgaactaa atgataaact gactaatgta aaataa                                 576
//

If you have problems or comments...

PBIL Back to PBIL home page