(data stored in SCRATCH zone)

EMBL: CP002105.PE258

CP002105.PE258       Location/Qualifiers
FT   CDS_pept        274050..274424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0260"
FT                   /product="flagellar protein FlaG protein"
FT                   /note="InterPro IPR005186; KEGG: hor:Hore_17070 flagellar
FT                   protein FlaG protein; PFAM: flagellar protein FlaG protein;
FT                   SPTR: B8CYT7 Flagellar protein FlaG protein; PFAM: FlaG
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11810"
FT                   /db_xref="InterPro:IPR005186"
FT                   /db_xref="InterPro:IPR035924"
FT                   /db_xref="UniProtKB/TrEMBL:D9QTP6"
FT                   /protein_id="ADL11810.1"
FT                   /translation="MKVSEVSNNQPTSSEQSKTRQIESTSQKDKVDLQAGEEETKEQKT
FT                   DEKKVTEENVKDGIEKLNETVQTFHEELKFEMHKESERMMTKVVNTEKHEVIKEIPPKE
FT                   VLDMIGRIKDMVGLILDEKI"
     ttgaaagttt ctgaagttag caacaatcaa ccaactagtt cagaacaatc gaaaacaagg        60
     cagattgaaa gtacttcaca gaaagataag gttgatcttc aggctgggga agaagaaact       120
     aaagaacaga agacagatga gaagaaagta actgaagaaa atgttaaaga tggcatagag       180
     aaattaaatg aaacagtaca gacctttcat gaagaattaa aatttgaaat gcataaagaa       240
     agtgagcgga tgatgactaa agtagtaaat acagaaaagc atgaagtaat taaagaaata       300
     ccaccaaaag aagttctcga tatgattggt cgaatcaaag atatggttgg tcttatattg       360
     gatgagaaga tataa                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page