(data stored in SCRATCH zone)

EMBL: CP002105.PE263

CP002105.PE263       Location/Qualifiers
FT   CDS_pept        282081..282827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0265"
FT                   /product="1-(5-phosphoribosyl)-5-amino-4-imidazole-carboxylate
FT                   (AIR) carboxylase"
FT                   /note="COGs: COG1691 NCAIR mutase (PurE)-related protein;
FT                   InterPro IPR000031; KEGG: dhd:Dhaf_2912
FT                   1-(5-phosphoribosyl)-5-amino-4-imidazole-carboxylate (AIR)
FT                   carboxylase; PFAM:
FT                   1-(5-phosphoribosyl)-5-amino-4-imidazole-carboxylate (AIR)
FT                   carboxylase; SPTR: Q24WP3 Putative uncharacterized protein;
FT                   PFAM: AIR carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11815"
FT                   /db_xref="GOA:D9QTQ1"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="InterPro:IPR039476"
FT                   /db_xref="UniProtKB/TrEMBL:D9QTQ1"
FT                   /protein_id="ADL11815.1"
FT                   /translation="MQPDRLKEILTKVEAGNLDVDTALEELKSPGYEDLGFAKVDQHRN
FT                   LRRGFPEVVLCEGKTEEQIVKIMQKLAETEENALATRADEDIYQAVKEELPEIEYNEAA
FT                   KTLVLQQTDLAEEGSILVISAGTSDIPVAEEAYETARIMGNSVERLYDVGVAGIHRLLE
FT                   NQKQLRQARVVIVAAGMEGALASVVGGLVDKPVIGVPTSVGYGASFEGVASLLGMLNSC
FT                   SAGVGVVNIDNGFGAAYLASSINKME"
     atgcagcctg atagattaaa agagatttta accaaagtag aggcaggaaa tctagatgtc        60
     gatactgccc tagaagagtt aaagagtccc ggttatgagg atttaggctt tgccaaagta       120
     gaccagcatc gtaatctacg gcggggcttt ccggaagtag ttctctgtga gggcaagaca       180
     gaagaacaga tagtgaagat aatgcagaag ctggctgaaa cagaggagaa tgctctggct       240
     accagagccg atgaagatat ttatcaagca gttaaggaag aactgcccga gattgagtat       300
     aatgaagcag cgaaaacttt agtcttacag cagacagatt tagccgagga aggatcaatt       360
     ttggtcatca gtgccggaac ttcggatatt ccagtagccg aagaggctta tgaaacagcc       420
     cgaattatgg gtaactccgt agaacggctc tatgatgtag gcgtagccgg tatccatcgt       480
     ctattagaaa atcagaagca gctgcgtcag gcccgggtag ttattgtagc agccggtatg       540
     gaaggagcat tggccagtgt agttggaggg ttagtcgata agccggtaat tggtgtgccg       600
     acaagtgtcg gctatggagc cagctttgaa ggagtagcat ccctgttggg tatgttaaat       660
     agctgttcag ccggcgtagg tgtggttaat atagataatg gctttggagc ggcctatcta       720
     gccagttcaa tcaataaaat ggaatag                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page