(data stored in SCRATCH zone)

EMBL: CP002105.PE266

CP002105.PE266       Location/Qualifiers
FT   CDS_pept        286849..287214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0269"
FT                   /product="NAD(P)-dependent iron-only hydrogenase
FT                   iron-sulfur protein"
FT                   /note="InterPro IPR012335:IPR012336; KEGG: nth:Nther_0098
FT                   ferredoxin-like protein; SPTR: A1HP39 NADH dehydrogenase
FT                   (Quinone); PFAM: Respiratory-chain NADH dehydrogenase 24 Kd
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11818"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D9QTQ4"
FT                   /protein_id="ADL11818.1"
FT                   /translation="MKSLDELNELKEKVQKDMKTRKSEGKPKVIVGMGTCGIAAGAREI
FT                   MQALLDEINKRDLDVIVTQTGCIGMCEKEPLVDVKLPGKDRITYGGVTEEDAQKIIVEH
FT                   VVNGNIVEDLLVAKLEE"
     atgaaatcat tagatgagtt aaatgaatta aaagaaaaag ttcaaaagga tatgaagaca        60
     agaaagagcg aaggcaaacc taaagtaatt gtaggcatgg ggacttgtgg tattgctgcc       120
     ggagcaagag agattatgca ggcgcttctg gatgaaataa ataagcgaga tctggatgta       180
     attgtaactc agaccggctg tatcggtatg tgcgaaaagg agccgttagt tgatgttaaa       240
     ctacccggta aggatagaat cacttatgga ggagtaactg aagaagatgc tcagaagata       300
     atagtagaac atgtagttaa cggtaatatt gtagaagatc tattagtggc taaattagaa       360
     gagtaa                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page