(data stored in SCRATCH zone)

EMBL: CP002105.PE27

CP002105.PE27        Location/Qualifiers
FT   CDS_pept        29085..30668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0027"
FT                   /product="D-3-phosphoglycerate dehydrogenase"
FT                   /note="COGs: COG0111 Phosphoglycerate dehydrogenase and
FT                   related dehydrogenase;
FT                   InterProIPR006139:IPR006140:IPR002912:IPR016040:IPR 006236;
FT                   KEGG: hor:Hore_11540 D-3-phosphoglycerate dehydrogenase;
FT                   PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding; D-isomer specific 2-hydroxyacid dehydrogenase
FT                   catalytic region; amino acid-binding ACT domain protein;
FT                   SPTR: B8CX87 D-3-phosphoglycerate dehydrogenase; TIGRFAM:
FT                   D-3-phosphoglycerate dehydrogenase; PFAM: D-isomer specific
FT                   2-hydroxyacid dehydrogenase, NAD binding domain; ACT
FT                   domain; D-isomer specific 2-hydroxyacid dehydrogenase,
FT                   catalytic domain; TIGRFAM: D-3-phosphoglycerate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11579"
FT                   /db_xref="GOA:D9QSC3"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR006236"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D9QSC3"
FT                   /protein_id="ADL11579.1"
FT                   /translation="MKVLVSDNISQAGIDILKDNGVDVTFNTELSYEELLEEIGKYDGI
FT                   ILRSMTPLNEEVLSQADNLKVIARAGSGYDNIDVEAASKRGIIVLNTPGQNTISAAEQT
FT                   MALMLGLSRNLPQANEALHEGIWDRNKYQGVEINQKTLGIIGLGRVGGNVATRAKSFNM
FT                   EVIANDPYIPAERGEKLGVELVGFKEVLKRSDYISIHTPLTDETYHILGKKEFAQMKEG
FT                   VRIVNAARGENVDTYELAEAIKEGKVAGAALDVHEEEPLKEEHPLLELEDRVIVSPHLG
FT                   GTTVEAMDNVAIDAAKQAISVLRGDLPRTPLNAPALQPEAMKEIEPYVNLAKKLGAFYA
FT                   QWGEGRIKELTISYRGELAEKEIGPVTTALLIGILNPILDTTVNSVNAGLIAEERGIDI
FT                   TESKSSTTERYSSLIELKVETEAGVNNLVGTVFDDTDLRIVEINGYRVNAISEGNLLIT
FT                   NHTDKPGVVGKIGTLLGENDINIANMQLGRHDAGGEAVMVMGIDNELNSEVKEKLLTID
FT                   GISDIKEVNL"
     atgaaagtat tagttagtga taatatctct caagcaggaa tcgatattct gaaggataat        60
     ggagtagatg taacctttaa tactgaacta tcttatgaag aattattaga agagattggt       120
     aagtatgatg gaattatctt aagaagcatg acgcctctta atgaggaggt tctaagccag       180
     gctgataatc taaaggtgat tgcccgagcc ggttctggtt atgataatat agatgtagaa       240
     gcagcttcaa aacgcggaat tattgtcttg aatactcctg gtcagaatac tatttctgct       300
     gctgaacaga caatggcttt gatgttagga ttatccagaa atcttcctca ggctaatgaa       360
     gctttacatg aaggtatctg ggatagaaat aagtatcaag gtgtagaaat aaatcaaaag       420
     accttaggaa ttatagggtt aggccgtgta ggaggaaatg tagcaacaag agcaaaatcc       480
     tttaatatgg aagtgatagc caatgatcct tatattccag ccgaacgggg tgaaaagctt       540
     ggagttgagt tagtaggctt taaagaagtc ttaaagagat ctgattatat ctctatccat       600
     acaccgctta cagatgagac ataccatatt ttaggcaaaa aagagtttgc tcagatgaaa       660
     gaaggagtta gaattgttaa tgcagcgcgc ggtgaaaatg ttgatactta tgagttggcc       720
     gaagcaatta aagaagggaa agttgctgga gctgctcttg atgtacatga agaagaaccg       780
     ttaaaagaag aacatccttt attggagttg gaggatagag taattgtttc tccacatttg       840
     ggcggtacta cagtagaagc tatggataat gtagccattg atgcagctaa acaggcaatt       900
     agcgtgctta gaggtgactt accaagaact ccactaaatg ctcctgctct acaaccagag       960
     gctatgaaag agattgaacc atatgtaaat ctagctaaaa agttaggtgc tttttatgct      1020
     cagtgggggg aaggaaggat aaaagaatta acaataagtt atagaggaga attagctgaa      1080
     aaggagattg gtccagttac cacagcttta ttaataggaa ttttaaatcc aattttagat      1140
     accacagtta attctgttaa tgcaggttta attgctgaag agcgtggaat tgatattaca      1200
     gaaagtaaga gttctactac tgaacgatac tctagtttaa ttgaattaaa ggtagaaaca      1260
     gaagcaggag ttaataattt agtaggaact gtttttgatg atactgattt aagaattgta      1320
     gagatcaatg gttacagagt aaatgctatt tccgaaggaa atctattaat tactaatcat      1380
     actgataaac caggagtagt aggaaagatt ggtactttgt taggtgaaaa tgatataaat      1440
     attgctaata tgcagttagg ccgtcatgat gcaggtggag aagctgtcat ggtaatgggc      1500
     atagataatg agttaaattc tgaagttaaa gaaaaacttt taactattga tggtatatca      1560
     gatattaaag aagttaacct ataa                                             1584
//

If you have problems or comments...

PBIL Back to PBIL home page