(data stored in SCRATCH zone)

EMBL: CP002105.PE270

CP002105.PE270       Location/Qualifiers
FT   CDS_pept        291851..292504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0273"
FT                   /product="amino acid ABC transporter membrane protein, PAAT
FT                   family"
FT                   /note="COGs: COG0765 ABC-type amino acid transport system
FT                   permease component; InterPro IPR000515:IPR010065; KEGG:
FT                   fno:Fnod_1057 polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; SPTR: A1HT15 Polar amino
FT                   acid ABC transporter, inner membrane subunit; TIGRFAM:
FT                   polar amino acid ABC transporter, inner membrane subunit;
FT                   PFAM: Binding-protein-dependent transport system inner
FT                   membrane component; TIGRFAM: amine acid ABC transporter,
FT                   permease protein, 3-TM region, His/Glu/Gln/Arg/opine
FT                   family; ectoine/hydroxyectoine ABC transporter, permease
FT                   protein EhuC"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11822"
FT                   /db_xref="GOA:D9QTQ8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR014342"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D9QTQ8"
FT                   /protein_id="ADL11822.1"
FT                   /translation="MYEAFVEALPFLLKGSVMTIKITTIAVGMGIILGNVLGLARVSKN
FT                   PIIGGVAKGYIEIFRGTPLLVQLFILYYGLPSLGINLTPYIAAVLGLGLNSGAYVGEIV
FT                   RGGIESIDKGQMEAARSVGMSYAQSMRYIILPQAFKSIVPALGNEFIALLKDSSLVSVI
FT                   AVKDLTRQGRLIISRTYQSFFIFLTVAVFYFIMVFIMTRLVNYAERKLKTSDQN"
     atgtatgaag cctttgttga agcattaccg tttcttctaa aaggttcagt aatgacaatt        60
     aagattacaa cgattgctgt aggaatgggg attattctag gaaatgtttt gggattagcc       120
     cgtgtttcta agaatccaat tatcggcggg gttgctaaag gttatattga aatatttagg       180
     ggaactcctt tattagttca gttatttatt ctttattacg gtttaccttc gctgggaatt       240
     aatttaactc cttatatagc ggcggtttta ggattaggat taaatagcgg agcctatgta       300
     ggagagattg ttcgcggcgg tattgaatcg atagataaag gacagatgga agcagcccga       360
     tcagttggaa tgtcgtatgc acagtcaatg aggtatatta ttctgcctca ggcctttaaa       420
     tcgattgttc cagcgttagg aaatgaattt attgctttgc ttaaagattc atctttagta       480
     tcagtaattg ctgttaaaga tttgacaaga cagggaagat taattattag tagaacttat       540
     caatcctttt tcatattttt aacagtagca gtattctatt ttataatggt atttatcatg       600
     actagacttg taaattatgc agaaaggaag ttaaagacca gtgatcaaaa ttga             654
//

If you have problems or comments...

PBIL Back to PBIL home page