(data stored in SCRATCH zone)

EMBL: CP002105.PE271

CP002105.PE271       Location/Qualifiers
FT   CDS_pept        292491..293213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0274"
FT                   /product="amino acid ABC transporter ATP-binding protein,
FT                   PAAT family"
FT                   /note="COGs: COG1126 ABC-type polar amino acid transport
FT                   system ATPase component; InterPro
FT                   IPR017871:IPR003439:IPR003593; KEGG: chy:CHY_0506 glutamine
FT                   ABC transporter, ATP-binding protein; PFAM: ABC transporter
FT                   related; SMART: AAA ATPase; SPTR: Q3AES0 Glutamine ABC
FT                   transporter, ATP-binding protein; PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11823"
FT                   /db_xref="GOA:D9QU30"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:D9QU30"
FT                   /protein_id="ADL11823.1"
FT                   /translation="MIKIENLYKNFGDLEVLKDINLEIDAGEVVVIIGPSGSGKSTVLR
FT                   CINLLEELTSGQIYIEETPMDDPETDINLMRQKVGMVFQQFNLFPHKTSLENITLAPTK
FT                   VKKLAEDEAENIAYELLDKVGLQDKADVYPAQLSGGQKQRIAIARALAMEPKVMLFDEP
FT                   TSALDPEMVGEVLEVMGTLAQEGMTMAVVTHEMGFAREVGDRICFMDEGRIVETGPPTQ
FT                   IFDNPQEERTQEFLSKIL"
     gtgatcaaaa ttgagaatct atataaaaat ttcggtgatc tggaagtttt aaaggatatc        60
     aatcttgaaa tagatgcagg tgaagtagtg gtaatcatcg gccctagcgg ttccggaaag       120
     agtacagtgc tgcgctgcat taatctttta gaggagttga cttctggcca gatctatatt       180
     gaggagactc ctatggatga tccggagact gatatcaatt taatgcgtca aaaagtaggt       240
     atggtttttc agcagtttaa tctctttccc cataagactt cactggaaaa tataacttta       300
     gctcctacta aggtaaagaa gctggctgaa gatgaagcag agaatattgc ctatgaatta       360
     ttggataagg taggtctaca ggataaggca gatgtctatc cagcccagct ttctggcggc       420
     caaaaacagc ggattgctat agccagagcg ctagccatgg agcctaaggt aatgttattt       480
     gatgagccta cttcagcttt ggatcccgaa atggtaggcg aagtattgga agtaatgggg       540
     actctagctc aggaaggaat gacaatggca gtagtgaccc atgagatggg ctttgcccgg       600
     gaggtaggag acagaatctg ttttatggat gaaggaagga tagttgaaac aggtcctcct       660
     actcagatct ttgataatcc gcaggaagaa agaactcagg aatttttgag taaaattctg       720
     taa                                                                     723
//

If you have problems or comments...

PBIL Back to PBIL home page