(data stored in SCRATCH zone)

EMBL: CP002105.PE273

CP002105.PE273       Location/Qualifiers
FT   CDS_pept        294027..296624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0276"
FT                   /product="protein translocase subunit secA"
FT                   /note="COGs: COG0653 Preprotein translocase subunit SecA
FT                   (ATPase RNA helicase);
FT                   InterProIPR000185:IPR011115:IPR011130:IPR001650:IPR
FT                   011116:IPR004027:IPR014018; KEGG: hor:Hore_16440 preprotein
FT                   translocase, SecA subunit; PFAM: SecA DEAD domain protein;
FT                   SecA preprotein cross-linking region; helicase domain
FT                   protein; SecA Wing and Scaffold; SEC-C motif domain
FT                   protein; SPTR: B8CYM4 Protein translocase subunit secA;
FT                   TIGRFAM: preprotein translocase, SecA subunit; PFAM: SecA
FT                   DEAD-like domain; SecA preprotein cross-linking domain;
FT                   SEC-C motif; SecA Wing and Scaffold domain; TIGRFAM:
FT                   preprotein translocase, SecA subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11825"
FT                   /db_xref="GOA:D9QU32"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/TrEMBL:D9QU32"
FT                   /protein_id="ADL11825.1"
FT                   /translation="MLGFLKKWLFKDPNEKELERIQPIVDKINGLEPQIQKLTDAELRA
FT                   KTDEFKERLEEGETLDDLMPEAFAVVREASQRATEEGFRHYDVQVVGAIVLHEGKIAEM
FT                   KTGEGKTLAATMPAYLNALTGNAVHIVTVNDYLAERDSEWMGQIYEFLGLDVGVILEDM
FT                   DTEERQEAYQADIVYGTNNQFGFDYLRDNMAIDKDDLVQGELSFAILDEVDSILIDEAR
FT                   TPLIISGPAESSPALYYKFARLAPRFKESKDYEVDEKANTVTLTEEGIARAEDILDIDN
FT                   LYLDENMDLHRHLKLSLRAKALMDKDEDYIVKDGEVHIVDEFTGRLMTGRRYGEGLHQA
FT                   IEAKEGVEIQKETQTLASITFQNFFRMYDKLAGMTGTAATEAEEFDEIYDLDVVVVPTN
FT                   EPVIREDYDDVIYQTEEAKFNAVVEDIIESHERGQPVLVGTRSIEKSEELSRKLRRNNI
FT                   PHNVLNAKHHEQEAEIIKNAGQEGAVTIATNMAGRGTDIVLGDGVVDKGGLYVIGTERH
FT                   ESRRIDNQLRGRSGRQGDPGASQFYVSLEDDLMRLFGSDKISSVMDSLGLEEDQPIEHS
FT                   LISRALENAQKKVESRNFEIRKQVLEYDNVMNKQRQVIYNQRRKILYGEDLKENILTMI
FT                   EKLVDEKLEVYINEEVHHEEWDLEGLINYAETLFLEEGDLEIDDLADCGRMKVKEKLLA
FT                   VAKENYEAREEEVDSEVMRELEKIVMLKVVDQKWMDHLQAMDDLRQGIGLRAYGQNDPL
FT                   VEYKNEAYDMFQNMISSIREDIIKYIFRIELVSGELESRDSSINIGRGEVPSAYDTVRA
FT                   QKEAEAKQAKRQQQKQQNQQPQKQQPIVKEEEPGRNDPCPCGSGEKYKRCCGR"
     atgcttggtt ttctcaagaa atggttattt aaggatccca atgaaaaaga attagaacgg        60
     atacagccta tagtagataa aattaatgga ttggagccac agatacagaa gttgactgat       120
     gccgaactga gagctaagac tgatgaattt aaagaaaggt tagaagaggg agagacatta       180
     gatgacctga tgcccgaggc atttgctgta gtacgggagg catcacagcg ggcaacagag       240
     gaaggctttc gccattatga tgttcaggtg gtgggagcta ttgtactgca tgaaggtaag       300
     attgctgaaa tgaagaccgg ggaaggaaag actttagcag caactatgcc ggcctatttg       360
     aatgctttaa ccggtaatgc agtccatatt gtaacggtta atgattatct agctgaacgg       420
     gatagtgagt ggatgggcca gatctatgaa tttctgggac tggatgttgg tgttatctta       480
     gaagatatgg atactgaaga gagacaggaa gcctatcagg ccgatatcgt ctatggaacc       540
     aataatcaat ttggtttcga ttatctacgt gataatatgg ccattgataa agatgatttg       600
     gttcagggag aattaagctt tgctatttta gatgaggtgg atagtatctt aattgatgag       660
     gcccggacgc cgttgattat ttcgggacca gccgaatcat ctccagccct ttattataag       720
     tttgccaggt tagctccgcg ctttaaagaa agtaaagatt atgaagttga tgaaaaggct       780
     aatactgtaa ccctgactga agaggggatt gcgcgggctg aggatatact tgatattgat       840
     aatctctatc tggatgagaa tatggatcta catcgtcatc tcaaactttc acttagagct       900
     aaagctttaa tggataagga tgaagactat atcgtcaaag atggagaggt ccatattgtt       960
     gatgaattta ccggccgttt gatgaccggc cggcggtacg gtgaagggct ccatcaggct      1020
     attgaggcta aagaaggagt cgaaattcaa aaggagacac agactctggc cagtattact      1080
     tttcagaact tctttagaat gtatgataaa ttggccggaa tgaccggaac agcagccact      1140
     gaggctgaag aatttgatga aatctatgat ctggatgtag tagtagttcc tactaatgaa      1200
     cctgtaatca gagaggatta tgatgatgta atctaccaga cagaagaggc taaattcaat      1260
     gccgtagtcg aagatattat tgaaagccat gagcgaggcc agccggtgtt agtaggaacg      1320
     agatcaatcg aaaaatccga ggagttaagc cggaaattaa ggcggaataa tattccccat      1380
     aatgtattga atgctaaaca tcacgagcaa gaagcagaga ttattaagaa tgccggacag      1440
     gaaggggcag tgacaattgc taccaatatg gccggccggg gaactgatat tgttttaggg      1500
     gatggtgtag ttgacaaggg cggcctctat gtgattggaa ctgagcgtca tgaaagcaga      1560
     cggatcgata atcagcttag aggacgttct ggacgccagg gagatcccgg tgcttcccag      1620
     ttttatgttt ccctggagga tgatctgatg cgcctctttg gctctgataa gatcagcagc      1680
     gtgatggaca gtttaggtct tgaagaggat cagccgattg aacattctct tatcagccga      1740
     gccttggaga atgcacaaaa gaaggttgaa tcccgcaact ttgagatcag aaaacaggtt      1800
     ttagagtatg ataatgtaat gaataagcag cgtcaggtta tctataacca gcgccggaag      1860
     atactctacg gtgaggattt aaaagagaat attctgacta tgattgagaa gttagttgat      1920
     gagaagttag aggtctatat taatgaagag gtccatcatg aggaatggga cctggaaggc      1980
     ttaatcaatt atgccgagac gttattttta gaagaaggag atctggagat tgatgattta      2040
     gctgactgcg ggcgaatgaa ggttaaagag aagctgcttg cagtagccaa agagaattat      2100
     gaagcccggg aagaagaagt agattccgag gttatgcgtg aattagagaa gatagttatg      2160
     ctgaaggtgg ttgatcagaa gtggatggat catctccagg ctatggatga tctgcgtcaa      2220
     ggaatcggac ttagagctta tggtcagaat gatccgctag tggaatataa aaatgaagct      2280
     tatgatatgt tccagaatat gatcagcagc attagagaag acattatcaa gtatatcttc      2340
     agaatcgagc tggtttctgg tgaattggag tccagagaca gcagtattaa tataggccgg      2400
     ggcgaggtac cgtctgctta tgatactgtt cgggcccaga aggaagctga agcaaagcag      2460
     gctaagcgtc aacagcagaa gcaacagaat cagcagcccc aaaagcagca gccgattgtc      2520
     aaagaagagg aaccgggacg gaatgatcct tgtccttgcg gcagcggcga aaagtataaa      2580
     agatgctgtg ggcgttaa                                                    2598
//

If you have problems or comments...

PBIL Back to PBIL home page