(data stored in SCRATCH zone)

EMBL: CP002105.PE283

CP002105.PE283       Location/Qualifiers
FT   CDS_pept        306366..307508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0286"
FT                   /product="protein of unknown function DUF610 YibQ"
FT                   /note="COGs: COG2861 conserved hypothetical protein;
FT                   InterPro IPR006837; KEGG: amt:Amet_4438 protein of unknown
FT                   function DUF610, YibQ; PFAM: protein of unknown function
FT                   DUF610 YibQ; SPTR: A6TWE2 Putative uncharacterized protein;
FT                   PFAM: Divergent polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11835"
FT                   /db_xref="GOA:D9QU42"
FT                   /db_xref="InterPro:IPR006837"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D9QU42"
FT                   /protein_id="ADL11835.1"
FT                   /translation="MNQKLGKICLIISGLLIISTLTACSSSTPTKTNVEKLNYIEISKD
FT                   IKDKVNSYWQQQELDFRSEMEWGRKKKEMIAEREVSWQKNFQKIELPFPSSKEQELDRL
FT                   LTGLKHKLTADEVKIELETESSGSEVAEAELTVKLQSAELKDKELTLYHLKMTQPKVKA
FT                   RMAFIIDDLGFNRDGTAELMEIDRPLTVAVLPFRPYSTSDAEKAVQAGHEILLHLPMEP
FT                   SSPVSPGEGAIYTDMAPEEIRTTIQKGLASLGVEVAGVNNHMGSKVTADNKTMSVVLDY
FT                   LHQQDLFFIDSSTAPRSVVPAAAREVGESYAVNHLFIDNIDDKERINKQIQYLADVALK
FT                   QGELITIGHIKPNTIQAIKELIPKLEEKGIQLVYVSELVK"
     atgaatcaaa agctaggaaa gatatgctta ataattagcg ggctgttaat tatctctact        60
     ttaacagctt gtagtagttc tactccaact aaaactaatg ttgaaaaact gaattatatt       120
     gaaataagca aagatattaa agataaggtt aattcttact ggcagcaaca ggaattggat       180
     tttaggtctg aaatggagtg gggacgcaaa aagaaagaaa tgattgctga aagggaagtt       240
     agttggcaga agaactttca aaagattgaa ctgccctttc cttcctcaaa agaacaagag       300
     ttagatagat tattaaccgg tctaaaacat aaattaacag cagatgaagt caaaatagaa       360
     ttagaaacgg aatcatccgg gtcagaagta gcagaggctg agttaacagt taagctgcag       420
     tcggcagaat taaaagataa ggaactgact ctgtaccact taaagatgac ccaaccaaag       480
     gttaaagcca gaatggcctt tattattgat gatttaggat ttaatcgaga tggtacggca       540
     gaattaatgg agatcgatcg tccattaaca gtagcagttt tgccgtttcg tccttattct       600
     acttctgatg ctgaaaaagc cgttcaagca ggccatgaga ttctgctgca tttacctatg       660
     gagccttcat caccggttag tccaggtgag ggagctatct atactgatat ggcccctgaa       720
     gaaattagga ctactataca gaagggactg gccagtcttg gagttgaggt agcaggtgtc       780
     aataaccata tgggttctaa ggttactgca gataataaga cgatgtctgt ggttttagat       840
     tatctccacc agcaggatct attctttatt gacagcagta cagcacctcg ttctgtagtg       900
     ccagctgcag ctagagaggt tggcgaatcc tatgctgtga atcatctctt tattgataat       960
     atcgatgata aggagagaat taataagcag attcagtatt tagctgatgt agctttgaaa      1020
     caaggtgagc tgattactat tggtcatatt aaaccgaata ctattcaggc tattaaggag      1080
     ttgattccta agctagagga gaagggaatt cagttagtct atgtttctga attagtgaag      1140
     tga                                                                    1143
//

If you have problems or comments...

PBIL Back to PBIL home page