(data stored in SCRATCH zone)

EMBL: CP002105.PE291

CP002105.PE291       Location/Qualifiers
FT   CDS_pept        318965..319312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0294"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11843"
FT                   /db_xref="UniProtKB/TrEMBL:D9QU50"
FT                   /protein_id="ADL11843.1"
FT                   /translation="MLALQQDVAVSASEVACCKISTNCAKLSEEAFKTKSMKILCCNTA
FT                   NSQYMLTATPIGDNHSDMSIASSQHFSGATLKTDLEPRTAEGQFLRMSETGRRTNGKRK
FT                   RFVDYNLQYHE"
     gtgcttgcgc tgcaacagga tgttgcggtt agcgctagtg aagtcgcttg ttgcaagata        60
     tcaactaatt gtgcaaaatt atctgaggaa gcgtttaaaa ccaaatcaat gaaaattttg       120
     tgctgtaata ctgcaaatag tcaatatatg cttacagcaa ctcccattgg tgataaccat       180
     agtgatatgt ctattgcaag tagtcaacat ttctctggag cgactcttaa aactgacctg       240
     gagccacgga cggcggaggg gcagtttttg agaatgagtg agacaggacg tcgaacgaat       300
     ggcaagcgca agagatttgt tgactataat ctgcaatatc atgaatga                    348
//

If you have problems or comments...

PBIL Back to PBIL home page