(data stored in SCRATCH zone)

EMBL: CP002105.PE298

CP002105.PE298       Location/Qualifiers
FT   CDS_pept        325080..325790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0301"
FT                   /product="LmbE family protein"
FT                   /note="COGs: COG2120 conserved hypothetical protein LmbE
FT                   homologs; InterPro IPR003737; KEGG: drm:Dred_2324 LmbE
FT                   family protein; PFAM: LmbE family protein; SPTR: C0GG03
FT                   LmbE family protein; PFAM: GlcNAc-PI de-N-acetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11850"
FT                   /db_xref="GOA:D9QU57"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR023842"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:D9QU57"
FT                   /protein_id="ADL11850.1"
FT                   /translation="MTVDLLAFGAHPDDVEIGAGGTLIKHHSDGYKTGIVDLTAGEMGS
FT                   NGTPQIRRKEALAASEVLGAEFRHCLKLPDAKISRDEEAIKSIVKEIRAAKPKVVLAPY
FT                   WKDRHPDHVNTSKLVTESCFKAGLKKFEATGPPYRPQAVVYYFLAAVDEPDFIVDIAEE
FT                   YETKTEALLCHTSQVSYNQEHDFQTVLNDSTFLDKLDARFRYLGSLVDAQYGEGFKYKQ
FT                   TIKVSDLTMLEGGV"
     atgacagttg atctattagc ctttggagcc catcctgatg atgtagaaat tggcgcagga        60
     ggaaccttaa tcaaacatca ttcagatggc tataagactg gaattgttga tttaacagcc       120
     ggtgaaatgg gaagtaatgg tacaccacag ataagaagaa aggaagcttt agctgctagt       180
     gaagtgttgg gagcagaatt taggcattgt cttaagctgc cggatgctaa gattagcaga       240
     gatgaagagg ctattaagtc gattgtgaaa gaaattagag ctgctaaacc taaagtagtt       300
     ctggctcctt attggaaaga ccgtcatcct gaccatgtca ataccagtaa gttagttacg       360
     gaatcctgtt ttaaagcagg attgaagaaa tttgaagcta ctggcccccc ttaccgtcct       420
     caagcagtag tttattactt tttagcagca gttgatgaac cggactttat agtcgatatt       480
     gctgaagaat atgagactaa gactgaagca ttgctctgtc atacttctca ggtaagctat       540
     aatcaggaac atgattttca gacagtcttg aatgattcta cttttcttga taaattggat       600
     gctagatttc gttatctagg atctttagta gatgcccaat atggagaagg ctttaagtat       660
     aaacaaacaa taaaagtatc tgatttaact atgctagaag gcggggtata g                711
//

If you have problems or comments...

PBIL Back to PBIL home page