(data stored in SCRATCH zone)

EMBL: CP002105.PE299

CP002105.PE299       Location/Qualifiers
FT   CDS_pept        325793..326914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0302"
FT                   /product="glycosyl transferase group 1"
FT                   /note="COGs: COG0438 Glycosyltransferase; InterPro
FT                   IPR001296; KEGG: hmo:HM1_2041 glycosyl transferase, group 1
FT                   family protein, putative; PFAM: glycosyl transferase group
FT                   1; SPTR: C0GG02 Glycosyl transferase group 1; PFAM:
FT                   Glycosyl transferases group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11851"
FT                   /db_xref="GOA:D9QU58"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR023881"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D9QU58"
FT                   /protein_id="ADL11851.1"
FT                   /translation="MKIGIVCYPSYGGSGVVATELGKQLAKQGHKIHFISYEPPFRLEQ
FT                   YYENIYFHQVEVPTYPLFKFPPYSLVLTNKINELITEEDLDIIHAHYAIPHSLAAYLAC
FT                   EITKGTEVKLITTLHGTDITLVGGQSSFKNITRFSIGASDGVTAVSDSLRQDAIDRFDL
FT                   SPKKVKRIYNFIDTTEYRRQKPEEPLQLTEGEEKIIIHISNFRDVKNIPDVIKIFSLIN
FT                   KEVSSKLVLVGDGPNRHSAKKLVDELDLADKVYFLGKQDNIIPLLSVSDLFLLPSEKES
FT                   FGLVALEAMACEVPVVASNSGGLPEVVIDGVTGFLSDPGAIEEMAHNGIELLENVELHN
FT                   QFAQNARHRVVTNFSAAEIVEEYQEYYQRLMNN"
     atgaagattg gaatagtatg ttatccttcc tatggcggca gcggagtggt agctactgag        60
     ctaggtaagc agctggctaa gcagggacat aagattcact ttatcagtta tgaaccgcca       120
     tttaggttgg aacagtatta tgagaatata tattttcatc aagtagaggt tcccacctac       180
     cctttattta agtttccccc ttattcatta gtcttaacta ataagataaa tgaattaatt       240
     acggaagaag acttagatat catccatgcc cattatgcta ttcctcattc cttagcagcc       300
     tatttggcct gtgaaataac aaagggaact gaggtaaagc tgattactac tttacacggg       360
     accgatatta ctttagttgg cggacagagt tcttttaaaa atataactcg attcagtatt       420
     ggagccagtg atggagttac tgctgtatct gatagtttgc gccaggatgc tatagataga       480
     tttgatcttt ctccaaaaaa agtcaagaga atctataatt ttatagatac cactgaatat       540
     aggagacaga agcctgaaga gccgctgcaa ctgactgaag gtgaggaaaa gattattatt       600
     catatctcta atttcaggga tgtcaagaat attcctgatg tgatcaagat tttttctctg       660
     attaataaag aagtaagcag caagttagta ttggtaggag acgggcctaa tcggcattcg       720
     gctaagaagt tagttgatga attggacttg gcagataaag tttatttttt agggaaacag       780
     gataatataa ttcctctttt atctgtatct gatctctttt tgctgccgtc agaaaaggaa       840
     agctttggtt tagtagccct tgaagctatg gcctgtgaag taccggtagt tgcttctaat       900
     agcggcgggc taccagaggt ggttattgat ggcgttaccg gctttttatc tgatccgggg       960
     gctatagagg aaatggctca caatgggatt gaattattgg agaatgttga gctgcataat      1020
     caatttgctc agaatgctag acatagagta gtgactaact tttcggcagc ggagattgtt      1080
     gaagagtatc aagagtatta ccaaaggtta atgaataatt ga                         1122
//

If you have problems or comments...

PBIL Back to PBIL home page