(data stored in SCRATCH zone)

EMBL: CP002105.PE305

CP002105.PE305       Location/Qualifiers
FT   CDS_pept        332141..332464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0308"
FT                   /product="Carbohydrate binding family 25"
FT                   /note="InterPro IPR005085; KEGG: hor:Hore_16020
FT                   carbohydrate binding family 25; PFAM: Carbohydrate binding
FT                   family 25; SPTR: B8CYI2 Carbohydrate binding family 25;
FT                   PFAM: Carbohydrate binding domain (family 25)"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11857"
FT                   /db_xref="GOA:D9QU64"
FT                   /db_xref="InterPro:IPR005085"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="UniProtKB/TrEMBL:D9QU64"
FT                   /protein_id="ADL11857.1"
FT                   /translation="MAEFDNVNIDPTPITAGENVTIEYDGLLSEAGAEEVYLHAGVGKE
FT                   EWNDVKTIRMNRAPDGSWKTTVRLNTTQDFKFCFKDAAENWDNNNGHNWSYQVHNGEQH
FT                   SFS"
     atggctgaat ttgataatgt aaatattgat cctaccccta ttactgctgg agagaatgta        60
     acaattgagt atgatgggtt attaagtgaa gcaggagccg aagaagtcta tctccatgct       120
     ggtgtaggta aagaagaatg gaatgatgtt aaaactatta gaatgaaccg tgctccagac       180
     gggagctgga agacaactgt cagattgaat actacccagg actttaagtt ctgcttcaaa       240
     gatgctgcag aaaactggga taataataat ggtcataact ggagctatca agttcataac       300
     ggtgaacagc attcattcag ttaa                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page