(data stored in SCRATCH zone)

EMBL: CP002105.PE308

CP002105.PE308       Location/Qualifiers
FT   CDS_pept        335220..336422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0311"
FT                   /product="glycosyl transferase group 1"
FT                   /note="COGs: COG0438 Glycosyltransferase; InterPro
FT                   IPR001296; KEGG: dae:Dtox_0787 glycosyl transferase group
FT                   1; PFAM: glycosyl transferase group 1; SPTR: A5CZ90
FT                   Glycosyltransferase; PFAM: Starch synthase catalytic
FT                   domain; Glycosyl transferases group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11860"
FT                   /db_xref="GOA:D9QU67"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D9QU67"
FT                   /protein_id="ADL11860.1"
FT                   /translation="MRVLMVSWEYPPVSIGGLASHVEELSQALVEEDVEVHLITQGGEV
FT                   SDRYAEENGVYIYRVDKPDISTPDFLTWAMLVNYNFLEVANRLVNELDFDLIHIHDWLV
FT                   GFTGKTLKHSYHLPLVVTIHATESGRNHGIYNSHQQYINDVEWLLGYESWRVICCSEYM
FT                   REEIHGLFQTPKDKIDIINNGVNLDTFDVEVESGFKDKYTDGNLVFYIGRLVQEKGVQH
FT                   LLEAVPQVLSTAPNTEFVIAGKGPKLDELKDQAHRMGIADHVTFPGYISEEEKEKLYQV
FT                   ADTAVFPSLYEPFGIVALEAMASKTPVVVSGVGGFDEIVDDGQDGLKALPGNPDSLAEK
FT                   IIKLLTDHNYAESLRNNGYRKAVEEYSWQGIARQTKEVYNQVLTKYLDSDWRHVEPITT
FT                   I"
     atgcgagtat taatggtgtc ctgggaatat cccccagtta gtattggtgg tttggccagc        60
     cacgttgaag aattatccca agcattggtt gaagaagatg ttgaagtaca tttaattaca       120
     cagggtggag aagtaagcga tagatatgct gaagagaatg gagtttatat ttatcgcgtc       180
     gataaacctg atatttctac tccagatttt cttacctggg ctatgttagt aaattataac       240
     tttttagaag tagcaaatcg cctggtgaat gagttagatt ttgatttaat acatatccat       300
     gactggttag taggatttac tggtaagacg ttaaaacata gctatcatct tccgttagta       360
     gttaccattc atgctacaga atcaggcaga aaccacggta tttataattc acatcagcag       420
     tatatcaatg atgtagagtg gttgcttggt tatgaatcct ggcgagtgat ctgttgtagt       480
     gaatatatgc gggaagagat tcatggtctt tttcagactc caaaggataa gatagatatt       540
     atcaataatg gagtaaatct ggatactttt gatgttgagg tagagtctgg atttaaagat       600
     aagtatactg atggtaactt agtcttttat attggacgtc tggttcagga gaagggagta       660
     cagcatctgt tagaagcagt tccccaggtt ttatcaacag cgcctaatac ggaatttgta       720
     attgctggca aaggacctaa gcttgatgag cttaaagacc aggcccatag aatgggaatt       780
     gctgaccatg ttacctttcc gggatatatt tcagaagaag aaaaggaaaa gttatatcaa       840
     gtagccgata cagctgtctt tcctagtcta tatgaaccat ttggtattgt tgctctagaa       900
     gctatggcca gcaagactcc ggtggttgtc tctggagtag gaggatttga tgagattgtc       960
     gatgatggcc aggatggatt gaaggctctg ccgggaaatc ccgattcatt agctgaaaag      1020
     attattaagt tattaactga tcataattat gctgaatctt tacgtaataa tggttaccgt      1080
     aaggcggtag aagagtacag ttggcagggt attgctcgtc agactaaaga ggtttacaat      1140
     caggtgctga ctaaatattt agattctgac tggagacatg ttgaaccgat aactacaata      1200
     taa                                                                    1203
//

If you have problems or comments...

PBIL Back to PBIL home page