(data stored in SCRATCH zone)

EMBL: CP002105.PE319

CP002105.PE319       Location/Qualifiers
FT   CDS_pept        348652..349650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0322"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase"
FT                   /EC_number="1.2.1.12"
FT                   /note="COGs: COG0057 Glyceraldehyde-3-phosphate
FT                   dehydrogenase/erythrose-4-phosphate dehydrogenase;
FT                   InterProIPR020830:IPR020832:IPR016040:IPR006424:IPR
FT                   020831:IPR020828:IPR020829; KEGG: sru:SRU_1200
FT                   glyceraldehyde-3-phosphate dehydrogenase, type I; PFAM:
FT                   Glyceraldehyde 3-phosphate dehydrogenase, NAD(P) binding
FT                   domain; Glyceraldehyde 3-phosphate dehydrogenase, catalytic
FT                   domain; PRIAM: Glyceraldehyde-3-phosphate dehydrogenase
FT                   (phosphorylating); SPTR: Q2S3A6 Glyceraldehyde-3-phosphate
FT                   dehydrogenase, type I; TIGRFAM: glyceraldehyde-3-phosphate
FT                   dehydrogenase, type I; PFAM: Glyceraldehyde 3-phosphate
FT                   dehydrogenase, C-terminal domain; Glyceraldehyde
FT                   3-phosphate dehydrogenase, NAD binding domain; TIGRFAM:
FT                   glyceraldehyde-3-phosphate dehydrogenase, type I"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11871"
FT                   /db_xref="GOA:D9QU78"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D9QU78"
FT                   /protein_id="ADL11871.1"
FT                   /translation="MTKKIAINGFGRIGRNIFRIIQQREDVDLEIVAINDLTDADNLAY
FT                   LLKYDSVHGRYDGEVEVGENGIKVDGKDYEVTSESDPANLDWSGKDIDIVIEATGVFRR
FT                   REQLEKHLKAGADKVVLTVPAKDKIDSTIVLGVNDDDLDESDQIVSNASCTTNCLAPMA
FT                   KVLNDEFGIEKGLITTVHGYTASQSILDAPAKKTRRGRTAAENIIPTTTGAAIATTKVL
FT                   PELEGKINGMAMRVPVPDGSVVDGVFDLETDVTVKEVNEAFKKAAEGEMEGILGYTEDE
FT                   LVSRDIIGSPYSSLIDAQSTMMIANNQIKVLSWYDNEWGYSNRVIELADRL"
     atgacaaaaa agattgcaat taatggattt ggaagaattg ggcggaatat attcagaatt        60
     attcaacaga gagaagatgt ggacttggag atagtagcca ttaatgattt aactgatgct       120
     gataatctgg cttatctact taagtatgat tctgttcacg gtagatatga tggagaagta       180
     gaagtcggcg agaatggtat caaagttgac ggtaaagatt atgaggttac ttctgaatct       240
     gatccggcta atttagactg gtctggtaag gatatcgata ttgttattga agctactggt       300
     gtttttcgcc ggcgagaaca gctcgaaaag catctaaagg cgggggctga taaggttgta       360
     ttgactgttc cggctaaaga taagattgac agcactattg tcttaggagt taatgatgat       420
     gatttagatg agtctgacca gattgtttcc aatgcttcct gtactactaa ctgcttagct       480
     cctatggcta aggtgttaaa tgatgaattt ggaattgaaa aagggttaat tactactgtt       540
     cacggttata cagctagtca atcaatcttg gatgcaccag ctaagaagac ccgtcgaggt       600
     agaacagctg ctgaaaatat tattcctaca actactggtg ctgctattgc tactactaag       660
     gtgctgccgg aactagaagg taaaattaat ggtatggcta tgcgagtacc ggtgccggat       720
     ggttctgtag ttgatggagt atttgattta gaaacagatg taacagttaa agaagtaaat       780
     gaagccttta agaaagcagc tgaaggagaa atggaaggaa ttttaggtta tacagaagat       840
     gagctagttt ctcgtgatat tattggttct ccttattctt ctttaattga tgcccagtca       900
     actatgatga ttgctaataa tcagatcaag gttctttctt ggtatgataa tgaatggggc       960
     tattctaatc gagtaataga gttagcggat agattataa                              999
//

If you have problems or comments...

PBIL Back to PBIL home page