(data stored in SCRATCH zone)

EMBL: CP002105.PE329

CP002105.PE329       Location/Qualifiers
FT   CDS_pept        360385..362505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0332"
FT                   /product="RNAse R"
FT                   /EC_number="3.1.-.-"
FT                   /EC_number="3.1.13.1"
FT                   /note="COGs: COG0557 Exoribonuclease R;
FT                   InterProIPR012340:IPR001900:IPR003029:IPR016027:IPR
FT                   011129:IPR011805:IPR004476:IPR013223; KEGG: hor:Hore_15730
FT                   ribonuclease R; PFAM: ribonuclease II; Ribonuclease B OB
FT                   region domain; RNA binding S1 domain protein; PRIAM:
FT                   Exoribonuclease II; SMART: Cold shock protein; SPTR: B8CYF3
FT                   Ribonuclease R; TIGRFAM: ribonuclease R; VacB and RNase II
FT                   family 3'-5' exoribonuclease; PFAM: RNB domain;
FT                   Ribonuclease B OB domain; S1 RNA binding domain; TIGRFAM:
FT                   ribonuclease R; VacB and RNase II family 3'-5'
FT                   exoribonucleases"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11881"
FT                   /db_xref="GOA:D9QU88"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004476"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR011805"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013223"
FT                   /db_xref="InterPro:IPR022966"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR040476"
FT                   /db_xref="UniProtKB/TrEMBL:D9QU88"
FT                   /protein_id="ADL11881.1"
FT                   /translation="MSAREEILNFMRNEAYKPLTAEELLSAFEISDQEKGIFLDLLDQM
FT                   EQDGEIVQTRRNRYGIPERMNLVVGRLERHSKGFGFLLPDDVEKEDVYINAGDVNGAMH
FT                   NDRIIARIKGVKSGDKLSGEVIRILERANQTVVGDFEANRNFGFVVPDDSHIYHDIFIP
FT                   KHDTNGASQGQKVVVEITRWPEERRNPEGKVVEILGNRGEPGVDIEAIIRKFELPKEFP
FT                   EEVKRYVDEIPEEIPAEEIERRSDLRDIKMVTIDGEDAKDFDDAVSIERLEGNKVRLGV
FT                   HIADVAYYVPEDSILDMEARERATSIYLVDRVIPMLPEKLSNNLCSLRDDEDKLAMTVF
FT                   MTYDLKTGELLDHEFMESVIEINHRLTYDKVKEMLVNEDQELINEYEDFIDELRLMEEL
FT                   CLQIRENRFNEGSLDFDFPESRVILDDDGKPVDIARVERSIAEKLIEEFMIATNRVVAK
FT                   EMFWREVPFIYRVHETPDQSDLEGLNEFIHNFGYHIKGISQETHPKSLQTVLEKVKGEQ
FT                   EERIVNTVLLRSMKQAHYEVQNIGHFGLAIDYYSHFTSPIRRYPDLMIHRIIKDVINQG
FT                   ILDPNRHQALEEKLPELAEHSSLRERQAEEAEYESKDLKKVEYMEGEEGEVYEGIISGM
FT                   MSFGFFVELPNLIEGLVHVSNLTDDYYIYHEDKQVYIGERTGNIYRLGDSVEVEVYQVN
FT                   LAERQIDLLLRN"
     atgagtgcaa gagaagaaat attgaatttc atgaggaatg aagcttataa gccgttaacg        60
     gctgaagaac tgttatctgc ttttgaaatt tctgatcaag aaaaaggaat atttttagat       120
     ttattagatc agatggagca ggatggggaa atagtacaga cgcgtcgaaa tagatacgga       180
     attccagaaa ggatgaattt agtagttgga agattggaac gacatagcaa aggattcggc       240
     ttcttattac cggatgatgt agagaaggaa gatgtttata tcaatgctgg agatgtaaat       300
     ggcgctatgc ataatgatcg gattatcgcc aggattaaag gtgttaaaag cggtgataag       360
     ctttctggtg aagttattag aattttggag cgggctaatc agacagttgt aggtgatttt       420
     gaagccaatc ggaattttgg ttttgttgtg cctgatgatt cccatatcta tcatgatatc       480
     tttataccta aacatgatac taatggggcc agtcagggac agaaggtagt agtagagatt       540
     actcgctggc ctgaagaacg caggaatccg gagggaaaag ttgtagaaat tctgggtaat       600
     cgtggagaac caggggtaga tatcgaggcg attatccgca agtttgaatt accaaaggag       660
     tttccagaag aggttaaaag atatgtggat gagattccag aagagattcc agctgaggag       720
     atagagagaa gaagtgattt acgggatata aagatggtga ctatagatgg cgaagatgct       780
     aaggattttg atgatgcagt atctattgaa aggttagagg gaaataaagt tagattaggc       840
     gttcatattg ccgatgtggc ctattatgta ccggaagatt ctattctgga tatggaggct       900
     cgagagcggg ctaccagtat ctatttagtt gatcgggtaa ttcctatgct gccggagaag       960
     ctgtcaaata atctctgtag tcttcgggat gatgaggata agttagccat gactgttttt      1020
     atgacttatg atttaaagac aggagaactg cttgaccatg aatttatgga gtctgtaatt      1080
     gagattaatc accggttgac ttatgataaa gtaaaagaga tgttagttaa tgaggatcag      1140
     gaattaatta atgaatatga agactttatt gatgaattga gattgatgga agaattatgt      1200
     ctacagatta gagagaatag gtttaatgaa ggaagccttg attttgactt tcctgaatca      1260
     agagtaatct tggatgatga tggaaagcct gtagatatag ctagagtgga acggagtata      1320
     gcagagaagt taatcgaaga atttatgata gctactaatc gagtggtagc taaagagatg      1380
     ttctggcgag aggttccatt tatttaccga gtccatgaaa cccctgatca gagtgattta      1440
     gaaggtttaa atgaatttat ccataatttt ggttatcata ttaaaggtat tagtcaggag      1500
     acccatccta agtcactgca gacagtatta gaaaaagtaa aaggggaaca ggaagagaga      1560
     atagtcaata ctgtcttgct gcggtctatg aagcaggccc attatgaggt ccagaatatc      1620
     ggtcatttcg gtttggcaat tgattattat tctcatttca cttcaccaat taggcggtat      1680
     ccggatctaa tgatacaccg gattatcaaa gatgttatca atcaagggat tttagatcct      1740
     aataggcacc aggctttaga ggagaagctg ccggagttag ctgaacattc ttctctgcgg      1800
     gagcggcagg cagaagaggc agagtatgaa tctaaggatc taaagaaagt agaatatatg      1860
     gaaggtgaag aaggagaagt ctacgaagga atcatcagcg gtatgatgtc ctttggtttc      1920
     tttgttgaac tgccgaattt aattgaaggt ttggtacatg tcagtaattt aactgatgat      1980
     tactatattt atcatgaaga taaacaggtc tatatcgggg aacggactgg aaatatctat      2040
     cgattaggcg acagtgttga agtagaagtc tatcaggtta atttagctga acgccagatt      2100
     gatctattat tacggaattg a                                                2121
//

If you have problems or comments...

PBIL Back to PBIL home page