(data stored in SCRATCH zone)

EMBL: CP002105.PE333

CP002105.PE333       Location/Qualifiers
FT   CDS_pept        368603..369085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0338"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11885"
FT                   /db_xref="UniProtKB/TrEMBL:D9QU92"
FT                   /protein_id="ADL11885.1"
FT                   /translation="MKRLIILFLIIGMLSFMVFDSGVNFPAKLETVGINWTIIAEDVSQ
FT                   VAMMVKQSTASLINIMFGKDKEVEEDIARYDAGEMHLEGEIKKISDNPRAIHIKLHMSD
FT                   INDKVDNPIEIASRAVFKIKEDKATFRSLQIGDIVGIIINPQGKARKITVYNRPQQ"
     atgaagaggt tgattattct atttttaata attggaatgt tatcttttat ggtatttgat        60
     tcaggagtaa actttcctgc taagttagaa acagtcggta ttaactggac gattatagcg       120
     gaagatgtat cacaggtagc aatgatggtt aagcaaagta cagctagttt aattaatatt       180
     atgtttggca aggataagga agtagaggag gatattgctc gttatgatgc aggagaaatg       240
     catctggaag gtgagataaa aaagatctct gataatccac gggcaattca tattaagttg       300
     catatgagtg atataaatga taaagtagat aatccaatag agattgcttc tagggcagtc       360
     tttaagatta aagaagataa ggcaactttt cgtagtttac agataggcga tatagtagga       420
     attattatta atccccaagg taaagcaaga aagatcaccg tttataatcg accacagcaa       480
     taa                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page