(data stored in SCRATCH zone)

EMBL: CP002105.PE336

CP002105.PE336       Location/Qualifiers
FT   CDS_pept        373370..374764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0341"
FT                   /product="peptidase U62 modulator of DNA gyrase"
FT                   /note="COGs: COG0312 Zn-dependent protease and their
FT                   inactivated homologs; InterPro IPR002510; KEGG:
FT                   mta:Moth_1542 microcin-processing peptidase 2; PFAM:
FT                   peptidase U62 modulator of DNA gyrase; SPTR: Q2RI88
FT                   Putative uncharacterized protein; PFAM: Putative modulator
FT                   of DNA gyrase"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11888"
FT                   /db_xref="GOA:D9QU95"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR025502"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:D9QU95"
FT                   /protein_id="ADL11888.1"
FT                   /translation="MLSEERIDKVLKSALDKGGEFAELFFEKKESNQLSMESSRLEKVK
FT                   TGFDLGVGIRVINGDQVSYAYTDDITLDSLLKTAKAAGTASKYNEDVTINNLQQKNTDS
FT                   VHQIEVRPETVEKLKKKEVLKTADKSARSVDQRIQQVMVSYIDYYQQVLIANSTGLLVE
FT                   DERVRTRLMVNAIASDGKIIQTGRETPGKHVGFELFDEYSPEEVGKKAGQKAITMLEAR
FT                   PAPSARMPVVVNHGFGGVLFHEACGHGLEADAVQKGSSVYTGRIGEQVANEKVTAIDDA
FT                   TVLNEWGSFVVDDEGHEAEETVLIKDGELTDYMYDYKTAKKEDRESTGNGRRQSYQSRP
FT                   IPRMTNTFIAPGESKPQEIINSVDQGLYAKSLSGGQVEPATGDFTFTVAEGYLIEDGEV
FT                   SEPVRNATLVGNGPESLHRITMVGDDLEHAPGMCGKEGQSIPAAVGQPTLLIEELTVGG
FT                   TEREEE"
     atgttaagtg aagaaagaat tgataaagta ctaaagtctg ccttggataa aggcggagaa        60
     tttgctgaac tcttcttcga aaagaaagag agtaatcagc tcagtatgga gagcagtaga       120
     ttggaaaaag taaagacagg atttgattta ggagtaggta tccgcgtgat caatggagat       180
     caggtttcct atgcctatac ggatgatatt acattggatt cactgttaaa gacagctaag       240
     gcagccggaa cagccagcaa gtataatgaa gatgtaacaa ttaataattt acagcagaag       300
     aatactgatt cagtccatca gattgaggtt agaccggaga cagtagagaa gctgaagaag       360
     aaagaagtac ttaagacagc cgataaatca gcccgtagtg ttgaccaaag aattcaacag       420
     gtaatggtca gttatataga ttattatcaa caggtcttga ttgctaactc aacaggactt       480
     ttagttgagg atgagcgggt aagaacccgg ctgatggtta atgcaattgc ctccgatggt       540
     aagattattc aaacaggccg cgagacgcca gggaaacatg tcggattcga gttgttcgat       600
     gagtattcgc cagaagaagt aggaaagaag gctggccaga aggcaattac tatgttagaa       660
     gctagacctg ctccgtcagc cagaatgccg gtagtagtca atcacggctt cggcggtgtc       720
     ttattccatg aagcctgcgg ccatggattg gaagccgatg ctgttcagaa aggatcatct       780
     gtctacacag gtcggattgg ggagcaagta gccaatgaga aagtaacagc cattgatgat       840
     gctactgtac tcaatgaatg gggttccttt gttgttgatg atgagggaca tgaggctgaa       900
     gagacagtct tgattaaaga tggtgaatta acagattata tgtatgacta taagacagcc       960
     aaaaaggaag atagagaatc taccggcaac ggtcgacgcc agtcttacca atcccggccg      1020
     attccgcgga tgactaatac ctttattgct cctggtgaat caaagcccca agaaataatc      1080
     aatagtgtag atcaagggtt gtatgctaag agtttaagcg gcggtcaggt agagccggca      1140
     accggtgact ttacctttac tgttgctgaa ggatacttaa ttgaagatgg tgaagtctcc      1200
     gaaccggttc gaaatgctac tttagtcggg aatggtcctg aaagccttca tcggattact      1260
     atggtcggcg atgatttaga acatgcgcca ggcatgtgcg gcaaagaagg acagagcata      1320
     ccagcagcag taggccagcc tactctgttg atcgaggaat tgacagttgg cggtacagaa      1380
     agggaggaag aataa                                                       1395
//

If you have problems or comments...

PBIL Back to PBIL home page