(data stored in SCRATCH zone)

EMBL: CP002105.PE339

CP002105.PE339       Location/Qualifiers
FT   CDS_pept        377255..377923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0344"
FT                   /product="sporulation protein YtaF"
FT                   /note="COGs: COG1971 membrane protein; InterPro
FT                   IPR014205:IPR003810; KEGG: bha:BH3151 hypothetical protein;
FT                   PFAM: protein of unknown function DUF204; SPTR: Q9K856
FT                   BH3151 protein; TIGRFAM: sporulation protein YtaF; PFAM:
FT                   Domain of unknown function DUF; TIGRFAM: putative
FT                   sporulation protein YtaF"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11891"
FT                   /db_xref="GOA:D9QU98"
FT                   /db_xref="InterPro:IPR003810"
FT                   /db_xref="InterPro:IPR014205"
FT                   /db_xref="UniProtKB/TrEMBL:D9QU98"
FT                   /protein_id="ADL11891.1"
FT                   /translation="MQIIPILLLALAISLDGLAVGITYGMRKIKLPLLSLIIISLTSAI
FT                   SVLISMLFGHLITNFLSVKVTEVLGGSILILIGLWILYQAVRQLLIEQTMNADISVNNN
FT                   SISDQPLFDFKIKSLGIVIKILKEPTRADFDYSGTISKQEAVFLGFALALDGFGAGIGA
FT                   AMTGFAPLLTASIAGVVIFGCLFLGLYLGDKYNLKEADSRITLLPGLLLIILGAVKLFK
FT                   "
     gtgcagataa ttccaatttt actactggct ttagctatta gtttagatgg tctggcagta        60
     ggaattactt atggtatgcg caaaattaaa ttacctcttc tatcgttgat tattattagc       120
     ttaacttcag ctatttcagt tttgatttcg atgttatttg gccatttaat aactaacttt       180
     ttatcggtta aagtaactga agttttaggt ggaagtatct taatcttaat tgggttatgg       240
     attctatatc aagcagtaag acagttatta attgaacaga caatgaatgc agatatttcg       300
     gttaataata attcgatttc tgaccagcct ttatttgatt ttaaaatcaa atctttggga       360
     atagtaatta agatattaaa ggaacctaca agagccgatt ttgattattc aggaaccatt       420
     agtaaacagg aagcggtctt tttaggtttt gcgttagctt tagacggctt tggagccgga       480
     ataggggctg ctatgaccgg gtttgctccg ttgcttacag cttctatagc tggagttgta       540
     atctttggct gtcttttttt ggggctttat ttgggagata aatataattt aaaagaggcc       600
     gattctagaa ttactctgct gccgggacta ttattaatta tattaggagc agtcaaatta       660
     tttaaataa                                                               669
//

If you have problems or comments...

PBIL Back to PBIL home page