(data stored in SCRATCH zone)

EMBL: CP002105.PE340

CP002105.PE340       Location/Qualifiers
FT   CDS_pept        377985..378599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0345"
FT                   /product="dephospho-CoA kinase"
FT                   /EC_number="2.7.1.24"
FT                   /note="COGs: COG0237 Dephospho-CoA kinase; InterPro
FT                   IPR001977; KEGG: chy:CHY_1647 dephospho-CoA kinase; PRIAM:
FT                   Dephospho-CoA kinase; SPTR: Q3ABL6 Dephospho-CoA kinase;
FT                   TIGRFAM: dephospho-CoA kinase; PFAM: Dephospho-CoA kinase;
FT                   TIGRFAM: dephospho-CoA kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11892"
FT                   /db_xref="GOA:D9QU99"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9QU99"
FT                   /protein_id="ADL11892.1"
FT                   /translation="MLIGLTGGIASGKSTVSNILKDIGIPVIDADLIAREVVKPGKPAW
FT                   QKIVNTFGNEVLLPNQQLDREKLSQIIFENSKAKEKLDQITHPEIIREIKKRIDSLQTQ
FT                   GEEVIVADIPLLIETGMVEFFDEIWVVYVSRQTQLKRLINRDEIDYQTAVNKIEAQMPL
FT                   EEKKEYADRLIVNEGDKGDLEDTIISIWREINAEKNCTNCP"
     atgttgatag gattaactgg aggaattgcc agcggtaaaa gtactgtcag taatatactt        60
     aaagatatag gtattccagt tattgatgct gatctgattg ctagggaagt ggttaagccg       120
     ggcaagccgg cctggcagaa aatagttaat acatttggta atgaagtatt attacctaat       180
     caacagcttg atagagaaaa attaagccag attatatttg agaattctaa agctaaagag       240
     aaactagatc agattactca tccggagata atcagagaaa ttaaaaagcg gattgatagt       300
     ctgcagaccc agggagaaga ggtgattgtt gctgatattc ctttattgat tgaaacaggg       360
     atggttgagt tctttgatga aatttgggta gtatatgtta gccgccaaac tcagttaaaa       420
     agattaataa atagagatga gattgattac cagacagcag ttaataagat agaagcccag       480
     atgccgttgg aagagaagaa agagtatgct gaccgtttaa tagttaatga aggagataaa       540
     ggggatttag aggatacaat aatatctatc tggagggaaa tcaatgccga aaagaattgc       600
     actaattgcc catga                                                        615
//

If you have problems or comments...

PBIL Back to PBIL home page