(data stored in SCRATCH zone)

EMBL: CP002105.PE341

CP002105.PE341       Location/Qualifiers
FT   CDS_pept        378568..378948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0346"
FT                   /product="methylglyoxal synthase"
FT                   /EC_number="4.2.3.3"
FT                   /note="COGs: COG1803 Methylglyoxal synthase; InterPro
FT                   IPR018148:IPR004363:IPR011607; KEGG: hor:Hore_04890
FT                   dephospho-CoA kinase; PFAM: MGS domain protein; PRIAM:
FT                   Methylglyoxal synthase; SPTR: B8D220 Dephospho-CoA kinase;
FT                   TIGRFAM: methylglyoxal synthase; PFAM: MGS-like domain;
FT                   TIGRFAM: methylglyoxal synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11893"
FT                   /db_xref="GOA:D9QUA0"
FT                   /db_xref="InterPro:IPR004363"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR018148"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:D9QUA0"
FT                   /protein_id="ADL11893.1"
FT                   /translation="MPKRIALIAHDEKKDDLIQFARDYQSTLSRFDLIATGTTGKLINE
FT                   RTELEVTRMQSGPLGGDQQIGAEVAHDRLDGIIFLRDPLTAQPHEPDVSALLRVCDVHD
FT                   IPISTNLATAIMVVTYLEADFD"
     atgccgaaaa gaattgcact aattgcccat gatgagaaga aggatgattt aattcaattt        60
     gccagggatt atcaatcaac attgagccga tttgatttaa ttgctaccgg tactactggt       120
     aaattaatta atgaaaggac tgaacttgaa gtaactagaa tgcagtctgg accgttaggc       180
     ggtgaccaac agatcggtgc tgaggtagcc catgaccgct tggatggtat tatttttctg       240
     cgtgatccgc tgacagccca gcctcatgaa cctgatgtta gtgcgctgct tagagtctgt       300
     gatgtgcatg atattcccat atctactaat ttagcaactg ctattatggt tgtaacttat       360
     ttagaagctg actttgatta a                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page