(data stored in SCRATCH zone)

EMBL: CP002105.PE345

CP002105.PE345       Location/Qualifiers
FT   CDS_pept        382150..382830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0350"
FT                   /product="putative transcriptional regulator, GntR family"
FT                   /note="KEGG: hor:Hore_04960 hypothetical protein; SPTR:
FT                   B8D227 Putative uncharacterized protein; PFAM: UTRA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11897"
FT                   /db_xref="GOA:D9QUA4"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="UniProtKB/TrEMBL:D9QUA4"
FT                   /protein_id="ADL11897.1"
FT                   /translation="MSLEEMTKKEQIINFARNDPFLKISDIAEHVQTTPRYVRTILSEA
FT                   DISLMKLREKYARNMEERLQVKDGNSQKAEIRLTNQQGDMETGNIRFNQITEQEFDELQ
FT                   KIDSEQELYKVSQRQLVNGEPFGLQEVITYLDSEVIEEKNQDLNSLYELFGEDSLSKLK
FT                   FKNNVMQVETANQFLAKLLDIDRDAPIIKSQRLILIGKMSVAIENCFFDANEVELVVPG
FT                   EFVI"
     atgagtttag aagaaatgac aaagaaagaa cagataatta attttgctag gaatgatcct        60
     ttcttgaaga tcagtgatat tgctgaacat gttcagacaa ctcctcgtta tgtcagaact       120
     attctttccg aggctgatat ttcactaatg aagttaagag aaaagtatgc ccggaatatg       180
     gaagagcgat tacaggtaaa ggatggtaat tcccagaagg cagagattag attgactaat       240
     caacagggtg atatggagac gggaaatatt agatttaatc agattactga acaggaattt       300
     gatgaactgc agaagattga ttctgaacaa gaattatata aagtatcaca gagacaattg       360
     gtaaatggag agccctttgg ccttcaggaa gtaattacat atttagactc agaagtgata       420
     gaagagaaga accaggattt aaattcatta tatgagttat ttggagaaga ttcactcagc       480
     aaattaaagt ttaagaataa tgttatgcag gtggaaacgg ctaatcagtt tttagcgaag       540
     ttattggata ttgatagaga tgctccaatt attaagagtc agcgcttgat tttaatcggt       600
     aagatgtcgg ttgctattga aaactgcttt tttgatgcta atgaggttga attagtggtt       660
     ccaggggaat ttgttattta a                                                 681
//

If you have problems or comments...

PBIL Back to PBIL home page