(data stored in SCRATCH zone)

EMBL: CP002105.PE350

CP002105.PE350       Location/Qualifiers
FT   CDS_pept        387459..387743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0355"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dat:HRM2_15230 hypothetical protein; SPTR:
FT                   C0Q9R8 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11902"
FT                   /db_xref="GOA:D9QUA9"
FT                   /db_xref="InterPro:IPR023878"
FT                   /db_xref="UniProtKB/TrEMBL:D9QUA9"
FT                   /protein_id="ADL11902.1"
FT                   /translation="MAQYTFRKKQDLFSLLKEMKLWPSRSGLLHGIKSIDTLGNYARLT
FT                   LYCGQEITVKNSKNSRAARWLRNTMMIEPCTECEVPDWKIEKYSNTTFK"
     atggctcagt atacttttag aaaaaagcag gatttatttt ctttattaaa agagatgaaa        60
     ctgtggcctt ctcgttcggg acttttacat gggattaaat cgatagatac tttaggcaat       120
     tatgcacgcc ttactttata ttgtggtcaa gagattacag taaagaattc taaaaacagt       180
     cgggcagctc gctggctgcg taatacaatg atgattgaac cctgtacaga atgtgaagtg       240
     cctgattgga agatagagaa atattctaat actactttta aataa                       285
//

If you have problems or comments...

PBIL Back to PBIL home page