(data stored in SCRATCH zone)

EMBL: CP002105.PE356

CP002105.PE356       Location/Qualifiers
FT   CDS_pept        complement(393731..394600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0361"
FT                   /product="transcriptional regulator"
FT                   /note="COGs: COG0583 Transcriptional regulator; InterPro
FT                   IPR011991:IPR000847:IPR005119; KEGG: hor:Hore_05450
FT                   transcriptional regulator, LysR family; PFAM: LysR
FT                   substrate-binding; regulatory protein LysR; SPTR: B8D275
FT                   Transcriptional regulator, LysR family; PFAM: Bacterial
FT                   regulatory helix-turn-helix protein, lysR family; LysR
FT                   substrate binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11908"
FT                   /db_xref="GOA:D9QUB5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9QUB5"
FT                   /protein_id="ADL11908.1"
FT                   /translation="MNLRELKIFVTVCETKNMSAAAKKLYISQPAISQTISTLEDKLNL
FT                   KLFDRLNRRLKLTHPGEILLNYSKRILNLVNETKNAMEDISNLNQGQLRIGSSMTIGTY
FT                   LLPQIIEEFQQKYKDINLPFIIDNTSVIEQMVLDNKIDLGLVEGPISSDNIVVEKFFTD
FT                   QLQLVCSTKHEWSHWKNLSPEKINEEDFIMREEGSGTRKVIENILANFNISCQITHVFN
FT                   NIEAIKKAVAANIGVSILPEISTKEERKKGKITKVNISGIEFKRNFSIIYHKDKYRSEI
FT                   FNKFIEHL"
     ttgaatttaa gagagcttaa aatatttgtt acagtctgcg aaactaaaaa tatgtcagct        60
     gcagctaaaa aattatacat aagtcagcct gctatcagtc aaactatctc taccttagaa       120
     gataaattaa atttgaagtt atttgaccgg ctaaacagaa gattaaaatt aactcaccct       180
     ggtgaaatac ttcttaatta tagcaagcgg attctaaacc ttgtaaatga aaccaaaaat       240
     gcaatggagg atatatccaa tctaaaccaa ggacagctgc gaattggaag cagtatgact       300
     ataggcactt atctattacc ccagataata gaagaattcc agcagaaata taaagatatt       360
     aacctaccct ttataattga taacaccagt gttatagaac agatggtctt agataacaaa       420
     atcgatttag gattagtaga aggacctatc agttctgata atattgtggt tgaaaagttc       480
     tttacagacc agcttcaatt ggtatgttct actaaacatg aatggagcca ctggaaaaac       540
     ctctccccgg aaaaaatcaa tgaagaagac tttatcatgc gggaagaggg aagcggtacc       600
     agaaaagtta ttgaaaatat tttggctaat tttaatatat cttgtcaaat cactcatgtt       660
     tttaataata ttgaagcaat taaaaaagct gtagcagcca acattggagt ctctatctta       720
     cctgaaatct caaccaaaga agaaagaaaa aaaggaaaaa taactaaagt aaatatctca       780
     ggaattgaat ttaaaagaaa cttcagtatt atttatcata aagataaata ccgctcagaa       840
     atcttcaaca aatttataga acatctataa                                        870
//

If you have problems or comments...

PBIL Back to PBIL home page