(data stored in SCRATCH zone)

EMBL: CP002105.PE357

CP002105.PE357       Location/Qualifiers
FT   CDS_pept        395220..396638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0362"
FT                   /product="Na-translocating NADH-quinone reductase subunit
FT                   A"
FT                   /note="COGs: COG4656 NADH:ubiquinone oxidoreductase subunit
FT                   RnfC; InterProIPR012285:IPR017900:IPR017896:IPR009051:IPR
FT                   011538:IPR008703:IPR001450; KEGG: hor:Hore_14350 electron
FT                   transport complex, RnfABCDGE type, C subunit; PFAM:
FT                   Na-translocating NADH-quinone reductase subunit A;
FT                   Respiratory-chain NADH dehydrogenase domain 51 kDa subunit;
FT                   4Fe-4S ferredoxin iron-sulfur binding domain protein; SPTR:
FT                   B8CY15 Electron transport complex, RnfABCDGE type, C
FT                   subunit; PFAM: Na(+)-translocating NADH-quinone reductase
FT                   subunit A (NQRA); NQRA C-terminal domain; TIGRFAM: electron
FT                   transport complex, RnfABCDGE type, C subunit;
FT                   NADH:ubiquinone oxidoreductase, Na(+)-translocating, A
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11909"
FT                   /db_xref="GOA:D9QUB6"
FT                   /db_xref="InterPro:IPR008703"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR010208"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR022615"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:D9QUB6"
FT                   /protein_id="ADL11909.1"
FT                   /translation="MKVKNKSFSGGYTFNLEGKPQDRVVELETPSKVVVPLKQGFGREV
FT                   EPNVEPGEEVKAGQIIGRDDESLSTPIQATVSGTVTEITDLPSNRRAVVIESDGTDDWQ
FT                   QLEDHSSNWNNLSAEEIEELLYTSGVTSLDNQGIPTRYKSSSISKDEVEHIIIEGTESN
FT                   PYNLSLSALLEENKLSQFVDGLQILHKVFPQAKVHVTINENRQQLIKELSDSAGNYDWI
FT                   QLYSSAPKYPQGKDEILVPTILGDDYKVRASVASYGVIVLKVQTILHIYDAVVEGKPLI
FT                   ERMVSLAGEGWQENIHLKVRIGTSIEAIMKNYSGSDNQRLIIGNLLTDKSIADYEIPVD
FT                   RTFDNLNAIPEQEVGEPFAFARPGAQKYSYSNSFLSALLSEVSSKCDTNVHGEERACIF
FT                   CGYCEDACPVDIIPHLVERYTAQSSVDEELIRYGIFDCIECNLCTFVCPSKRPVGKHIK
FT                   QGKQFLLNKGYVVK"
     atgaaagtta aaaacaagtc attttctgga ggttatacgt ttaatcttga gggtaagcct        60
     caggatagag ttgttgaatt agaaactcct tcgaaagttg ttgttccttt aaagcagggg       120
     tttggcagag aagtagaacc caatgttgag ccgggtgaag aagtgaaagc tggtcagatt       180
     attggtagag atgatgaatc tttgtctact cctatacagg caacggttag cggaactgta       240
     acagagatta cggatttacc ttcaaatagg agagcagttg tcattgagtc agatgggaca       300
     gatgattggc agcaattaga agatcattca tctaattgga ataatctatc agctgaagaa       360
     attgaagaat tactttatac ttccggagtt acttccttgg ataaccaggg aattccgact       420
     agatataaga gttcatcaat ttctaaagat gaagtagagc atataattat tgaaggtact       480
     gagtctaatc cttataactt atcattatca gctcttttag aagaaaataa gttatcacag       540
     tttgttgatg gattacagat actccacaaa gtctttccac aggctaaagt acatgtaact       600
     atcaatgaaa atcgacagca attaattaaa gaattaagtg attctgctgg aaattatgat       660
     tggattcagc tgtatagttc agctcctaag tatcctcaag gtaaggacga aatattagtt       720
     cctacaattt taggtgacga ttataaagta agagcttctg tagcaagtta tggtgtaatt       780
     gtcttaaaag tccagactat tctgcatatt tatgatgctg ttgtagaagg aaaaccgttg       840
     atagagcgga tggtatcgct ggctggagag ggctggcagg aaaatattca ccttaaagtt       900
     cgaattggta cttctattga agctattatg aaaaattact ctggtagtga taaccagagg       960
     cttattattg gtaatttatt aacagataaa tctattgcag attacgagat accggttgac      1020
     cgcacttttg ataatttaaa tgcgatcccg gaacaggaag taggcgagcc gtttgccttt      1080
     gcgcgtccag gagctcaaaa atattcttat tcaaattcat tcttatctgc cttactttct      1140
     gaggtctcta gtaaatgtga tactaatgtt catggagaag aaagggcttg tatcttctgt      1200
     ggttactgtg aagatgcttg tccagttgat ataattccac atcttgttga acggtataca      1260
     gctcagagca gtgtcgatga agagcttatt agatatggta tttttgactg tatagaatgt      1320
     aacttgtgta catttgtttg tccatctaaa agacctgtag gtaagcatat caagcaggga      1380
     aaacagttct tgctcaataa aggatatgta gtgaagtaa                             1419
//

If you have problems or comments...

PBIL Back to PBIL home page