(data stored in SCRATCH zone)

EMBL: CP002105.PE359

CP002105.PE359       Location/Qualifiers
FT   CDS_pept        397757..398401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0364"
FT                   /product="FMN-binding domain protein"
FT                   /note="COGs: COG2869 Na+-transporting NADH:ubiquinone
FT                   oxidoreductase subunit NqrC; InterPro IPR007329; KEGG:
FT                   fno:Fnod_0630 FMN-binding domain-containing protein; PFAM:
FT                   FMN-binding domain protein; SPTR: A7HKQ2 FMN-binding domain
FT                   protein; PFAM: FMN-binding domain; TIGRFAM: NADH:ubiquinone
FT                   oxidoreductase, Na(+)-translocating, C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11911"
FT                   /db_xref="GOA:D9QUB8"
FT                   /db_xref="InterPro:IPR007329"
FT                   /db_xref="InterPro:IPR010204"
FT                   /db_xref="UniProtKB/TrEMBL:D9QUB8"
FT                   /protein_id="ADL11911.1"
FT                   /translation="MMGSFTMKTNTNLEQEVQTKDILLGKAKMIIFMLILGLVAAALLA
FT                   GLGSYTKPLVEKNKELRTMQKVLESINVDYSSDNLTKVFKEKVEVVNEGEYKFYKTKEG
FT                   EVAFKFEGEGIWAPIVGFAALDSDMETLEGISIMSQGETPGLGGRITEDWFLNQFKGLK
FT                   RNPKIVVLKASKTADNPNEVDGIAGATLSGKALQKILNKNIEVALQKLEVN"
     atgatggggt cgtttacaat gaaaactaat actaatttag aacaggaagt gcaaactaag        60
     gatattctgt tgggtaaggc taagatgata atctttatgt taatcttggg tttggttgca       120
     gctgctttat tagcaggatt gggttcttat actaaacctc ttgtggagaa gaataaagaa       180
     ttaagaacaa tgcagaaagt tcttgaatct attaatgtgg attattcaag tgataattta       240
     acaaaggtct ttaaagaaaa ggtcgaggtt gtaaatgaag gcgaatataa attttacaag       300
     accaaagaag gcgaagttgc ttttaaattt gaaggtgaag ggatttgggc tccaattgtt       360
     ggttttgcag cccttgactc tgatatggaa accctagaag ggatttcaat aatgtcccag       420
     ggagagactc ctggtcttgg cggtcgaatt acagaagatt ggtttcttaa tcagtttaaa       480
     ggcttaaaac gcaatccaaa aattgtagtt ttgaaagcaa gtaaaacagc tgataatcct       540
     aatgaagtag atgggattgc tggagcaacg ttgtctggta aggctttaca gaagatttta       600
     aataagaata ttgaagtggc tttgcagaaa ctggaggtga actaa                       645
//

If you have problems or comments...

PBIL Back to PBIL home page