(data stored in SCRATCH zone)

EMBL: CP002105.PE362

CP002105.PE362       Location/Qualifiers
FT   CDS_pept        399734..400825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0367"
FT                   /product="oxidoreductase FAD/NAD(P)-binding domain protein"
FT                   /note="COGs: COG2871 Na+-transporting NADH:ubiquinone
FT                   oxidoreductase subunit NqrF;
FT                   InterProIPR012675:IPR001221:IPR001709:IPR001041:IPR
FT                   017927:IPR017938:IPR008333:IPR001433; KEGG: acl:ACL_0970
FT                   Na+-transporting NADH:ubiquinone oxidoreductase subunit F;
FT                   PFAM: oxidoreductase FAD/NAD(P)-binding domain protein;
FT                   Oxidoreductase FAD-binding domain protein; ferredoxin;
FT                   SPTR: A9NGV0 Na+-transporting NADH:ubiquinone
FT                   oxidoreductase subunit F; PFAM: 2Fe-2S iron-sulfur cluster
FT                   binding domain; Oxidoreductase FAD-binding domain;
FT                   Oxidoreductase NAD-binding domain; TIGRFAM: NADH:ubiquinone
FT                   oxidoreductase, Na(+)-translocating, F subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11914"
FT                   /db_xref="GOA:D9QUC1"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:D9QUC1"
FT                   /protein_id="ADL11914.1"
FT                   /translation="MNIQPIYILASIFFGVAFVLAIADFLLTSNEQQVININDEEYIPA
FT                   GDGTLLEVLGENGIFIPAGCGGKASCGQCKVTVKEGGGDILPTEEPFLDEEEREEGVRL
FT                   ACQVKVNEDMKLELDESLLDIEEYTARVAEVRSVTPTVKHVRLEMIEPTDIEFEAGQYA
FT                   QIMIPGFEEYRAYSIASPPSMAREENALQFTIKLVPGGLCTSWVHFAMEEGDIVKFTGP
FT                   FGHFYLDEESDREIILIGGGAGMAPMRGILERLDELGMPRPTRYYFGARNSDELYYGDR
FT                   FAELEEKYDNFEYIPALSDPTPEDKKNWDGPTGFVTDVLDEREGSLENAESYLCGPPPM
FT                   LDAAERILVDHGMPEEKVMFDKF"
     atgaatattc aaccaatcta tatattagct tcaattttct ttggggttgc tttcgtgttg        60
     gcgattgctg atttcttatt gaccagtaat gagcagcagg taattaacat taatgatgaa       120
     gagtatattc cggctggaga tggaacattg ttggaagttt taggtgaaaa tggcatcttc       180
     attcctgcag gttgtggtgg aaaagcaagc tgcggtcaat gtaaggttac agtaaaagaa       240
     ggcggcggtg atatactacc tacagaagaa cctttcctcg acgaagaaga aagagaagaa       300
     ggagtcaggc ttgcctgtca ggtaaaagtc aatgaagata tgaaacttga gcttgatgaa       360
     tcattactgg atatagaaga atatactgct cgagtagctg aggtgaggag tgtaactcct       420
     acagttaaac atgttagatt agaaatgata gaaccaacag atattgagtt tgaagctggg       480
     cagtatgcac agattatgat acctggtttt gaagaatatc gggcttactc tatagcttca       540
     ccgccgagta tggccagaga agagaatgct ttacagttta caattaaatt ggtacccggc       600
     ggtctctgta ctagctgggt tcactttgct atggaagaag gtgatatcgt taagttcact       660
     ggccccttcg gtcacttcta tctcgatgaa gaatctgata gagagattat tctgatcggt       720
     ggaggagccg gtatggcacc tatgagagga attcttgagc ggctagatga attggggatg       780
     ccccggccga caagatatta ctttggtgcc agaaactcag atgagcttta ctatggagac       840
     agattcgcag aacttgaaga gaagtatgat aactttgagt atatacctgc actgtctgac       900
     cctactccgg aagacaaaaa gaattgggat ggtcctactg gatttgttac tgatgtactg       960
     gatgagagag aaggatcact ggagaatgca gaatcctatc tctgtggacc accgcctatg      1020
     cttgatgcag ctgaacgcat cttagttgat catggaatgc cggaagaaaa ggtaatgttt      1080
     gataaattct aa                                                          1092
//

If you have problems or comments...

PBIL Back to PBIL home page