(data stored in SCRATCH zone)

EMBL: CP002105.PE37

CP002105.PE37        Location/Qualifiers
FT   CDS_pept        39100..40032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0037"
FT                   /product="thiamine pyrophosphate protein domain protein
FT                   TPP-binding protein"
FT                   /note="COGs: COG1013 Pyruvate:ferredoxin oxidoreductase and
FT                   related 2-oxoacid:ferredoxin oxidoreductase beta subunit;
FT                   InterPro IPR011766; KEGG: csc:Csac_1461 thiamine
FT                   pyrophosphate binding domain-containing protein; PFAM:
FT                   thiamine pyrophosphate protein domain protein TPP-binding;
FT                   SPTR: A4XJH6 Thiamine pyrophosphate enzyme domain protein
FT                   TPP-binding; PFAM: Thiamine pyrophosphate enzyme,
FT                   C-terminal TPP binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11589"
FT                   /db_xref="GOA:D9QSQ1"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D9QSQ1"
FT                   /protein_id="ADL11589.1"
FT                   /translation="MSKVNLKELSHQDERLTGGHRLCSGCGASIIVRQILHATQDPVVV
FT                   GCATGCLEVSTTIYPYTAWKDSFIHNAFENSAATVSGVEAAYRSLKKQGKIDEETKFLA
FT                   FGGDGGTYDIGFQSLSGAMERGHDMVYVCYDNGAYMNTGIQRSSATPRNASTTTSPAGE
FT                   VIPGKQQFRKELTDIVAAHNIPYVAQASPHKFKDLVRKAKKAFEVEGPAFLNVLSPCPR
FT                   GWRYPEDEAMDLLRSATDSCFWPLYECEDGEWKLNYKPKEKAPITDWLKPQGRFKHVFK
FT                   EGNEHLVDEIQEHVDQRWETILHRCGETE"
     atgtctaaag ttaatttaaa agaattatca catcaggatg aaaggttgac cggtggacat        60
     agattatgtt caggatgtgg agcttcaatt attgtgcgac agattttaca tgccacacaa       120
     gatccagtgg tagttggttg tgcaacaggt tgtcttgagg tttcaactac tatttatcct       180
     tatactgctt ggaaagactc tttcattcat aatgcttttg aaaattctgc tgcaactgtt       240
     agtggtgtag aagctgctta tcgttcttta aagaagcagg gtaagatcga tgaagagaca       300
     aagtttttag cttttggtgg tgatggtgga acttacgata tcggtttcca atcactttct       360
     ggagctatgg aacgtgggca tgacatggtt tatgtctgtt atgataacgg tgcttatatg       420
     aatactggta ttcagcgttc cagtgctaca cctagaaatg ctagtacaac aactagtcca       480
     gctggagaag taattcctgg taagcagcag tttagaaaag agttgactga tatagttgct       540
     gctcataaca ttccttatgt tgcccaggct tcaccacata agtttaagga tttagtacga       600
     aaagctaaaa aagcctttga agtagaagga ccggccttct tgaatgtatt atctccatgt       660
     ccaagaggat ggagatatcc agaagatgag gctatggatc tattgagatc agctacagat       720
     agctgtttct ggccgttata tgagtgtgaa gatggtgagt ggaagttaaa ttacaagccg       780
     aaagaaaagg ctccaattac tgattggtta aagccgcagg gtagatttaa gcatgtcttt       840
     aaagaaggta atgagcattt agttgatgag atccaagaac atgttgacca gagatgggaa       900
     acaattcttc accgctgtgg agaaactgaa taa                                    933
//

If you have problems or comments...

PBIL Back to PBIL home page