(data stored in SCRATCH zone)

EMBL: CP002105.PE379

CP002105.PE379       Location/Qualifiers
FT   CDS_pept        416749..417246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0384"
FT                   /product="cell wall hydrolase SleB"
FT                   /note="COGs: COG3773 Cell wall hydrolyses involved in spore
FT                   germination; InterPro IPR011105; KEGG: tte:TTE2551 spore
FT                   cortex-lytic enzyme prepeptide; PFAM: cell wall hydrolase
FT                   SleB; SPTR: Q8R773 Spore cortex-lytic enzyme prepeptide;
FT                   PFAM: Cell Wall Hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11931"
FT                   /db_xref="GOA:D9QUD8"
FT                   /db_xref="InterPro:IPR011105"
FT                   /db_xref="InterPro:IPR042047"
FT                   /db_xref="UniProtKB/TrEMBL:D9QUD8"
FT                   /protein_id="ADL11931.1"
FT                   /translation="MKKIATVLIIVLLLGVGGWLARGWMTDRQLQQQVEPVQTRWAPNF
FT                   WSLSPNTRLMARTISAEARGETYLGQVAVGSVIMNRVRSDKFPNSISGVIYQPWAFTAV
FT                   ARGHVWDHTPESDSIRAALDAMSGWDPTYGSIYYYNPADVTTYWIFSRPQVRQIGKHIF
FT                   AR"
     atgaagaaga tagctactgt attaattata gtactgcttt taggtgtagg aggttggttg        60
     gcaagaggct ggatgacaga tagacagcta cagcagcaag tcgagccggt tcagacaaga       120
     tgggccccga atttttggag tctatcgcca aatactagat tgatggcaag aactatctca       180
     gctgaagcac gaggtgaaac atatctcggt caagtagcag taggttcagt tattatgaac       240
     cgagttagaa gtgataaatt tcctaattca atttccggag ttatctatca accatgggct       300
     tttactgctg ttgctcgggg acatgtctgg gaccatactc cggaatcaga ttctattcgt       360
     gctgctttag atgcaatgtc aggttgggat ccgacttatg gttcaatcta ttattataat       420
     ccagctgatg taactactta ttggatcttt tctagaccac aggtaagaca gataggaaaa       480
     catatctttg cacggtaa                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page