(data stored in SCRATCH zone)

EMBL: CP002105.PE384

CP002105.PE384       Location/Qualifiers
FT   CDS_pept        422749..422946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0389"
FT                   /product="LSU ribosomal protein L35P"
FT                   /note="InterPro IPR018265:IPR001706; KEGG: nth:Nther_1822
FT                   LSU ribosomal protein L35P; PFAM: ribosomal protein L35;
FT                   SPTR: B2A5P0 50S ribosomal protein L35; TIGRFAM: ribosomal
FT                   protein L35; PFAM: Ribosomal protein L35; TIGRFAM:
FT                   ribosomal protein L35"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11936"
FT                   /db_xref="GOA:D9QUE3"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/TrEMBL:D9QUE3"
FT                   /protein_id="ADL11936.1"
FT                   /translation="MPKMKTHKGAKKRFKKTSKGKYKRKRTKRNHLMTKKNSNKKRKLR
FT                   KDATVKKCDEDTLDTLMPND"
     atgcctaaaa tgaagacaca taaaggtgct aagaagcgat ttaaaaagac ttctaaaggg        60
     aagtataagc gtaagaggac taaaagaaac catttaatga ctaaaaagaa ttctaataaa       120
     aagagaaagt tacgtaaaga tgctactgta aagaagtgtg atgaagatac tctggataca       180
     ttgatgccga atgactag                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page