(data stored in SCRATCH zone)

EMBL: CP002105.PE386

CP002105.PE386       Location/Qualifiers
FT   CDS_pept        423681..425024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0391"
FT                   /product="potassium uptake protein, TrkH family"
FT                   /EC_number="3.6.3.14"
FT                   /note="COGs: COG0168 Trk-type K+ transport systems membrane
FT                   components; InterPro IPR004772:IPR003445; KEGG:
FT                   hor:Hore_11710 potassium uptake protein, TrkH family; PFAM:
FT                   cation transporter; PRIAM: H(+)-transporting two-sector
FT                   ATPase; SPTR: B8CXA2 Potassium uptake protein, TrkH family;
FT                   TIGRFAM: potassium uptake protein, TrkH family; PFAM:
FT                   Cation transport protein; TIGRFAM: potassium uptake
FT                   protein, TrkH family"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11938"
FT                   /db_xref="GOA:D9QUE5"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:D9QUE5"
FT                   /protein_id="ADL11938.1"
FT                   /translation="MQLSDKFSLDNLTPAQFLSLGYLVVILTGTVLLSLPIATASGIRM
FT                   PLIDALFTATSATAVTGLIVENTKNFFSGFGQIVILILIQIGGLGIMSMSTLFAMIVGK
FT                   KITLKERLVIKQDLDQFELSGIIRLVRYVLFVTLVIEGTGALILFSRLIRDYDPLRALY
FT                   LAIFHSVSAFNNAGFDIFGNSLENFTGDLTINLVITTLIILGGIGFAVIAEIYKGEKKF
FT                   KNYSLQTKLVLSISGSLILLGTIVVFVLEYSNPATMGNLPLHGKALASYFMSVTPRTAG
FT                   FNTVPTGSLHNTTLFFVIILMFIGASPGSTGGGIKTTTFGSVLAVVYAMMTGKEDIEAF
FT                   KRRIPKDVIFKALSIIIISVLLIVVVTMILTVTEDMPFLDLFFETVSAFGTVGLSTGVT
FT                   GKLSGIGKLLIILTMFAGRVGPLTLFLAIGRKRIKGNIRYPEEKVLVG"
     atgcagctta gtgataaatt cagtttagat aacttaactc cagcccagtt tctgtcatta        60
     ggttatttag ttgttatttt aactggaaca gttttattat cgcttccaat tgctactgct       120
     agcgggataa gaatgccctt gattgatgct ttatttactg ctacttcagc tacggcagta       180
     acaggattaa ttgttgagaa taccaaaaac ttcttttccg gttttggtca gatagtaatt       240
     ttaattttaa ttcagatcgg cggtttagga attatgagta tgtccactct ctttgctatg       300
     attgtcggaa aaaagattac tcttaaagag cggttagtga ttaaacagga tttagaccaa       360
     tttgaactgt caggaattat tagattagtt cggtatgttc tgtttgttac gttagttata       420
     gaaggaactg gagctttaat tctattttcg cgtttgattc gcgattatga tcctcttagg       480
     gcactttatt tagctatttt tcattcagtt tccgccttta ataatgctgg atttgatatt       540
     tttggtaata gtttagagaa tttcacagga gatttgacta ttaatttagt gattactacg       600
     ctgataattt taggtggaat tggttttgcc gttattgctg aaatatataa aggagagaag       660
     aagtttaaaa attattcact gcagactaag ttagttttgt caattagtgg ttctttaatc       720
     ttgctaggta cgatagttgt cttcgtttta gagtattcaa atccagcaac tatgggtaat       780
     ctgccgttgc atggaaaggc tttggcctct tattttatgt cagtaactcc aagaacggcg       840
     ggctttaata cagtaccgac gggtagttta cataacacca ctctattttt tgttattatt       900
     ttaatgttta ttggtgcttc ccctggttcg actggcggtg gaattaaaac gactacattt       960
     ggttcagtat tagcagtagt ctatgcaatg atgactggca aagaggatat agaggcattt      1020
     aagcgtagaa taccaaagga tgttatcttt aaagcattat caattatcat aatttctgtt      1080
     ttgttaatag tagttgtaac tatgatactg acagttactg aagatatgcc atttctggat      1140
     ctcttctttg aaacagtttc tgcttttggt actgtgggct tatcgactgg agtaaccgga      1200
     aagttatctg gaataggtaa attattaatc attctaacta tgtttgctgg gcgagtggga      1260
     ccattgactt tatttttagc tattggacgc aaaagaataa aaggcaatat tagatatcca      1320
     gaagaaaaag ttttagttgg ttaa                                             1344
//

If you have problems or comments...

PBIL Back to PBIL home page