(data stored in SCRATCH zone)

EMBL: CP002105.PE390

CP002105.PE390       Location/Qualifiers
FT   CDS_pept        427820..428626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0395"
FT                   /product="tRNA/rRNA methyltransferase (SpoU)"
FT                   /note="COGs: COG0566 rRNA methylase; InterPro
FT                   IPR013123:IPR001537; KEGG: hor:Hore_05620 tRNA/rRNA
FT                   methyltransferase (SpoU); PFAM: tRNA/rRNA methyltransferase
FT                   (SpoU); RNA 2-O ribose methyltransferase substrate binding;
FT                   SPTR: B8D292 tRNA/rRNA methyltransferase (SpoU); PFAM: SpoU
FT                   rRNA Methylase family; RNA 2'-O ribose methyltransferase
FT                   substrate binding; TIGRFAM: rRNA methylase, putative, group
FT                   3"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11942"
FT                   /db_xref="GOA:D9QUE9"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:D9QUE9"
FT                   /protein_id="ADL11942.1"
FT                   /translation="MSEVISSFKNSKIKFLRSLYRKKYRRRNNKFILEGSRIITDALEA
FT                   KADIDQIFYSAQFLSQQKNKELLAQLREVTEIIEITDSLLNKIADTATPQGIIAIVNQP
FT                   EFELEDFLIEDNDLFLIIDRIQDPGNLGTILRTADGAGVDGVFLLKGTVDIYNLKTIRA
FT                   TMGSLFRVPVFGLNSPSDLTDILQMKDIQMVAADIEAKDYYYELDYNQPTALVIGNEGA
FT                   GAQPETLKLADKKVKIPLSEGIDSLNAAIASGIIMYEMVRQRKNNP"
     atgtcagaag taatctctag tttcaagaat tctaagatta agtttctgcg ttcattatat        60
     agaaagaagt atcgccggcg taataataag tttattttag aaggaagtag aattattact       120
     gatgcacttg aggccaaagc agatattgat caaatctttt attcagccca atttttatct       180
     caacagaaga ataaagaact gcttgctcaa cttagagaag taactgaaat aattgaaatt       240
     actgattcct tactaaataa gatagcagat acagctactc ctcaggggat tatagctatt       300
     gttaatcagc cggagtttga attggaagat tttttaatag aagataatga tttattttta       360
     attattgatc ggattcagga tcccggtaac ttaggaacga ttctgcggac agccgatgga       420
     gctggagtag atggagtctt tcttttaaaa ggaactgttg atatctataa cttgaagact       480
     attcgggcta ctatgggctc attatttaga gttcctgtct ttgggttaaa ttcgccaagt       540
     gatttgacgg atatattaca gatgaaagat attcagatgg tagcagctga tatagaagct       600
     aaagattatt attatgagct ggattataat cagccgacag cactggttat cggaaatgaa       660
     ggagcaggag cccagcctga aactcttaaa ttagctgata agaaggttaa aattccatta       720
     tctgagggta ttgattcact gaatgcagca attgcttctg gaattattat gtatgaaatg       780
     gtaagacaga gaaaaaataa cccctaa                                           807
//

If you have problems or comments...

PBIL Back to PBIL home page