(data stored in SCRATCH zone)

EMBL: CP002105.PE397

CP002105.PE397       Location/Qualifiers
FT   CDS_pept        441952..442905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0402"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dae:Dtox_2392 hypothetical protein; SPTR:
FT                   C1T9G0 Putative uncharacterized protein; PFAM: NIF3 (NGG1p
FT                   interacting factor 3)"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11949"
FT                   /db_xref="InterPro:IPR036069"
FT                   /db_xref="UniProtKB/TrEMBL:D9QUP0"
FT                   /protein_id="ADL11949.1"
FT                   /translation="MELEKIYELALELGIEADPRGKEEVERKLKEIREEYDEMDEEEKG
FT                   EFDEAKLENPYSDTRILYGDQAREVESILVGIDIDVSEVLIADRLTEKGRNIDLVMSHH
FT                   PEGKALAALHQVMHMQEDILYEHGVPINVAEDIMAERIQEVERRLMPVNHNKTRDAARI
FT                   FDIPLLSVHTPADNLVTEYLQSKIDKEKPDKVENVVQLLKEIPEYKEAVTEKAGPKVVV
FT                   GSEDRRAGKVVVDMTGGTSGSKEAFKNLSQAGVGTLVCMHIGEEHRKKAEENHINVVIA
FT                   GHMASDSIGLNLFLDRLEEKGIEIIPCSGLIRVVRN"
     atggaattag agaaaatcta tgaattggct ttagagctgg gaattgaagc tgaccccaga        60
     ggaaaagagg aagttgagag gaaattaaaa gagatcagag aagaatatga tgagatggat       120
     gaagaagaaa aaggagagtt tgatgaagct aaactggaga atccttattc tgatactaga       180
     attctgtatg gagaccaagc aagagaagta gagagtatct tagttgggat tgatattgat       240
     gttagtgaag tactaattgc tgatagatta acggaaaagg ggagaaatat agatttagtt       300
     atgtcccatc atcctgaagg caaagcactc gcagccttac atcaggtgat gcatatgcag       360
     gaagacattc tttatgaaca tggagttccg attaatgtag cagaagacat aatggctgag       420
     agaattcaag aagttgaacg aagactaatg ccggttaatc acaataagac tagagatgct       480
     gctcgtatct ttgatattcc tctactttct gtccatactc cggcggataa tttagtaaca       540
     gagtatctac agagtaagat tgataaggag aaaccagaca aagtagagaa tgtagttcag       600
     ttgcttaaag agataccgga atataaagaa gcagttactg agaaggcagg acctaaggtt       660
     gtcgtgggta gtgaagatag acgagctggt aaagtagtgg ttgatatgac cggtggaact       720
     agtggttcca aagaagcatt taagaatcta tcccaggccg gagtaggtac tttagtctgt       780
     atgcatatcg gtgaagaaca tcgtaaaaag gcagaagaga accatattaa tgtagttatt       840
     gctggacata tggccagcga ttctattgga ttgaatctat ttctggatag attagaagaa       900
     aaggggattg agattatacc ttgttcaggt ctaattagag tagtaaggaa ttaa             954
//

If you have problems or comments...

PBIL Back to PBIL home page