(data stored in SCRATCH zone)

EMBL: CP002105.PE398

CP002105.PE398       Location/Qualifiers
FT   CDS_pept        442925..445330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0403"
FT                   /product="MutS2 family protein"
FT                   /note="COGs: COG1193 Mismatch repair ATPase (MutS family);
FT                   InterProIPR000727:IPR002625:IPR007696:IPR000432:IPR 005747;
FT                   KEGG: hor:Hore_05680 MutS2 family protein; PFAM: Smr
FT                   protein/MutS2; DNA mismatch repair protein MutS domain
FT                   protein; SMART: DNA mismatch repair protein MutS domain
FT                   protein; MutS III domain protein; Smr protein/MutS2; SPTR:
FT                   B8D298 MutS2 protein; TIGRFAM: MutS2 family protein; PFAM:
FT                   MutS domain V; Smr domain; TIGRFAM: MutS2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11950"
FT                   /db_xref="GOA:D9QUP1"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR005747"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="UniProtKB/TrEMBL:D9QUP1"
FT                   /protein_id="ADL11950.1"
FT                   /translation="MEQHVLEILEYNKIKKRLAKHTSSKLARKLVDNLKPVSDFDFIQE
FT                   RQLEVTAAKKILNREEKYPPLGGIKDVRDSLKRTSKEITLNGEELVEIADTLSTSRNLK
FT                   RYLLNLEDEEDEYKSVVKYGTQLDNFKPLERKINKAVDNQGNVLDTASTKLRNIRRSIT
FT                   DYSQRIKDKLNSILSSKKYQSYIQDSLVTIRDKRYVIPIKSQFQEKVSGIVHDQSASKQ
FT                   TVFIEPMAVVKLNNKLRSFMAEEEEEVYRILTELTYEVREELDRIKETLKLLAWLDFTF
FT                   AKAEYSFKIEGAEPVLNQEEYINLEKARHPLIPQDEVVPIDIKLGGKFDTLVITGPNTG
FT                   GKTVTLKTVGLLTLMAQSGLHIPALSGSKIAVFDEIHGDIGDEQSIEQNLSTFSSHMTR
FT                   IIDILETAQENNLVLLDEIGAGTDPTEGAALAMAILEELYSRGRINTIATTHYSQLKTF
FT                   AYQQEGIQNASVEFDVETLQPTYRLQMGMPGRSNAFEIAGRLGLPTEVIEKARAKLSEE
FT                   DIEVDRIIQSIEESKQSIVENEEAARKERKKAKELKEEYETKLEEVEKLEQKIKKDAYA
FT                   EAEKIIAESKKKVNEVVTEMKEKAEVNQQEVDRAKSKIDEYKYNLSSERVDLESDLKQQ
FT                   RIQQNSEDLEVGDKVRLKKLNKEGEIIELSEDKEEAVIQAGPMKVNVDISRLEQMDESD
FT                   QQTEASNNSNGLNNDTNIGSLKNKKSRHISPKLDLRGLRAIEAKEKVDKYLDDAYLANI
FT                   SKAEIVHGKGSGVLREVVHDLLDEHSQIDEYRLGGKDEGGSGVTIVKF"
     ttggagcagc atgtcctaga aattctagaa tataataaga taaaaaagag attagctaag        60
     catacatctt ctaaactcgc ccgtaaactg gttgataatt taaaaccagt aagtgatttt       120
     gactttattc aagagcggca gttagaagta acagctgcta aaaagattct gaatagagaa       180
     gagaagtatc cacctttagg tggaattaaa gatgtcaggg attcattgaa aagaactagc       240
     aaagaaatta ctttgaatgg agaagaatta gtagagatag cagatactct atcaactagc       300
     cgaaatttaa agaggtatct gttgaattta gaagacgaag aagatgaata taaaagtgta       360
     gttaagtatg gtactcagtt agataacttt aaacctctgg aacgtaagat aaataaggct       420
     gtggataatc agggcaatgt attggatact gcaagtacta agctgcggaa tattcgccgc       480
     agcattactg attacagcca gcggattaag gataaattaa attcaattct gagttcaaag       540
     aagtatcaga gttatattca ggattcattg gttacaatta gagataaaag atatgtaatt       600
     ccgattaaaa gccagtttca ggagaaagtc tctggtattg ttcatgacca gtcggcaagt       660
     aagcagactg tatttattga accgatggct gtcgttaaac tgaataataa gttacgcagt       720
     ttcatggcag aagaagaaga agaagtctat cgaatcttaa cagaactgac ttatgaagtc       780
     agagaagaat tggatagaat taaagaaacc ttaaaattac tggcctggtt ggattttact       840
     tttgctaagg ctgaatacag cttcaagatt gaaggagcag aacctgtctt aaatcaggaa       900
     gagtatatta atctggagaa ggcaagacat cctctgattc cacaagatga ggtagtacca       960
     attgatatta aattaggcgg caaatttgat acattggtaa ttactggtcc caatactgga      1020
     ggaaagacag taactcttaa gacagtagga ttattgacat taatggccca gtctggcctt      1080
     catattcctg ccttgtccgg ttcaaagata gcagtatttg atgaaattca tggcgatatt      1140
     ggtgatgagc agagtattga gcagaactta agtacttttt cttcccatat gacgcggatt      1200
     attgatattc ttgagacggc tcaagagaat aatttagttt tgcttgatga gataggagcg      1260
     ggaactgatc ctaccgaggg tgctgcttta gctatggcaa ttttggaaga attatatagc      1320
     cggggtcgga ttaatacgat agctaccact cactatagtc aattaaagac ttttgcttat      1380
     caacaggaag gaattcagaa tgcttcggtg gaatttgatg ttgaaactct acagcctacc      1440
     tatagactac agatgggaat gcctgggcgc agtaacgcct ttgaaattgc tggtaggtta      1500
     ggcctgccaa cagaggtgat tgagaaggct cgggctaagt tgagtgaaga agatatagag      1560
     gttgatagga ttattcagag tattgaggag agcaaacaga gtatcgtaga gaatgaggag      1620
     gctgcccgga aagaaaggaa gaaggctaaa gaattaaaag aagaatatga aaccaaactg      1680
     gaggaagtgg aaaagttaga acagaagata aagaaggatg cttatgctga agctgaaaag      1740
     ataattgctg agtctaaaaa gaaggttaat gaagtagtaa ctgaaatgaa agagaaggct      1800
     gaagttaatc aacaggaagt ggatagagct aagagtaaaa tagatgaata taaatataac      1860
     ttaagtagtg agcgagtaga tttagaatca gaccttaaac agcagaggat acagcaaaat      1920
     tcagaggatt tggaagtagg agataaggtt cgactcaaga agttaaataa agaaggggaa      1980
     ataattgaac tttctgagga taaagaagaa gcagtaattc aggctgggcc aatgaaggtg      2040
     aatgtagata ttagtcgttt agaacagatg gatgaatctg accaacaaac agaagcaagt      2100
     aataattcta atggattaaa taatgatact aatattggca gtcttaaaaa taaaaaatct      2160
     cgccatattt ctcctaaact ggatttgaga ggtttgagag caatagaggc taaagaaaaa      2220
     gtggataagt atctggatga tgcttattta gccaatattt ctaaagcaga aatagtccac      2280
     ggcaagggct ccggtgtttt gcgggaggta gttcatgatc ttttagatga gcattctcag      2340
     atagatgagt atagactagg cgggaaagat gaaggaggat caggtgtaac tatcgttaag      2400
     ttttaa                                                                 2406
//

If you have problems or comments...

PBIL Back to PBIL home page