(data stored in SCRATCH zone)

EMBL: CP002105.PE40

CP002105.PE40        Location/Qualifiers
FT   CDS_pept        41445..42893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0040"
FT                   /product="VWA containing CoxE family protein"
FT                   /note="COGs: COG3552 Protein containing von Willebrand
FT                   factor type A (vWA) domain; InterPro IPR008912; KEGG:
FT                   dae:Dtox_0807 VWA containing CoxE family protein; PFAM: VWA
FT                   containing CoxE family protein; SPTR: C1TCM7 Protein
FT                   containing von Willebrand factor type A (VWA) domain; PFAM:
FT                   VWA domain containing CoxE-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11592"
FT                   /db_xref="InterPro:IPR008912"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:D9QSQ4"
FT                   /protein_id="ADL11592.1"
FT                   /translation="MQDSDDLVKEVDESINIFSAEEKPDYVENNMIKFIQILRNLGIKI
FT                   SLAESIEAMEALKLTDIIDKKEVKATLRSLLVKNNYEREIFDEAFEAFFVAQKEKQQRQ
FT                   EARKQEIKQQEEAKRKAEEDLTFKREKGISNKDEELELNLTDEQKETYTQLPEEAKQKI
FT                   RDYIEDSFPGHLQYSSNVQPMLEKMVGGLLNYWKRQLKNSDQERQQQHDLESKLTGDLE
FT                   MDTVIQQVVSSLQEDESLLTQDLKKIPEEKLSQVTMIIKKLSHKLATKISRRFQNSLKT
FT                   DKIDLRKTIRNNIKYGGVMLDLEYKTKKIQKPKFLVICDVSDSMARYATFVLQFIYGIS
FT                   SAIQDIESFIFSEDLERITEYFNSNLSFKDTMAKVITNSEEWGETTNLNQALETFQHQH
FT                   LDLLTPETILFIMSDTKTLQYKEAAAKLEDMRDHLKDIVWLNTLDQSEWDELESVQAFK
FT                   EVTRMVECYTIKHLNNSLKINILT"
     atgcaggata gtgatgactt agttaaagag gttgatgagt ctattaatat tttttctgca        60
     gaagagaaac ctgattatgt agagaataat atgataaaat ttattcagat tttacgtaat       120
     ttagggatta aaatcagttt agctgaatca attgaagcaa tggaagcctt aaaattaact       180
     gatattattg ataaaaaaga ggttaaagct actctccgtt ccttgttagt caaaaacaat       240
     tatgaacgag agatcttcga tgaagctttt gaggctttct ttgttgctca gaaagaaaag       300
     caacagagac aggaagccag aaagcaggaa attaaacagc aggaagaggc caaaaggaaa       360
     gcagaagaag atttgacctt taagcgggag aagggaataa gtaataaaga tgaagaactt       420
     gagttaaatc tgactgatga gcaaaaagaa acttatactc aattacctga agaagctaag       480
     cagaagatca gagattatat agaggatagt tttcctggcc atttacagta ttcttcaaat       540
     gttcaaccta tgttagaaaa gatggttggt ggattattga attactggaa gcgtcagtta       600
     aagaatagtg atcaagaaag gcaacaacag catgatctcg agtcgaaact aaccggtgat       660
     ttggagatgg atacagtaat tcaacaggtt gtttcttctc tgcaggaaga tgagtcatta       720
     ttaactcagg acttaaagaa gattcctgaa gagaagctat cccaagtgac gatgattatc       780
     aaaaagctat cccataaatt ggctactaaa atttcgcggc gcttccaaaa tagtttaaag       840
     acagataaaa tcgaccttag aaaaacaatc aggaataata ttaaatatgg cggagtaatg       900
     ctggatttgg agtataaaac taagaagatt caaaaaccga agttcttagt aatctgtgat       960
     gtatcagatt ctatggcccg ttatgctaca tttgttttgc agtttatcta tggtatttcc      1020
     agtgctatcc aagatataga aagtttcatt ttttctgaag atttagagag aattactgag      1080
     tattttaata gtaatttatc atttaaagat acaatggcta aagttattac caatagtgaa      1140
     gaatggggag aaacaactaa tctaaatcag gctttggaga cttttcagca ccagcatctt      1200
     gatttattaa ctccagaaac tattcttttt atcatgagtg atactaagac tttacagtat      1260
     aaagaagcag cagcaaaact agaagatatg cgtgatcatc taaaagatat agtctggttg      1320
     aatacgttag accaatctga atgggatgag ctggaatctg ttcaggcttt caaagaggta      1380
     actagaatgg tggaatgcta tacaataaaa catcttaata attctctgaa aattaatatt      1440
     ttaacttaa                                                              1449
//

If you have problems or comments...

PBIL Back to PBIL home page